Property Summary

NCBI Gene PubMed Count 71
PubMed Score 193.83
PubTator Score 154.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 9.80052724483319E-64
non-small cell lung cancer 2798 1.39136615818014E-29
Breast cancer 3099 3.30823674049404E-23
atypical teratoid / rhabdoid tumor 4369 5.76281269120315E-10
sonic hedgehog group medulloblastoma 1482 9.32523515122578E-9
medulloblastoma, large-cell 6234 7.60185552358137E-8
malignant mesothelioma 3163 5.49093003669286E-7
posterior fossa group A ependymoma 1511 8.75806951716997E-7
pediatric high grade glioma 2712 1.2150346455012E-6
lung cancer 4473 1.66515865344837E-6
primitive neuroectodermal tumor 3031 2.70853967523298E-6
breast carcinoma 1614 3.41058196413051E-6
adrenocortical carcinoma 1427 1.2425776996981E-5
pancreatic cancer 2300 2.86252579383233E-5
glioblastoma 5572 3.45180653888506E-5
ovarian cancer 8492 6.51450930448881E-5
primary Sjogren syndrome 789 1.09886727145739E-4
Atopic dermatitis 944 1.81563316150777E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.10405390014456E-4
invasive ductal carcinoma 2950 3.61466616272289E-4
ulcerative colitis 2087 4.06401058531547E-4
nasopharyngeal carcinoma 1056 4.14160591615454E-4
lung adenocarcinoma 2714 6.10404509145082E-4
ductal carcinoma in situ 1745 8.91121449984342E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00139701876845239
interstitial cystitis 2299 0.00935007600234179
Endometriosis 535 0.0105169437026898
colon cancer 1475 0.0147439137552372
esophageal adenocarcinoma 737 0.0200879813124423
pancreatic carcinoma 567 0.0277989247949247
Disease Target Count Z-score Confidence
Cancer 2346 4.247 2.1
Disease Target Count
Familial cancer of breast 12

Expression

Synonym

Accession O75330 A8K3G2 B4E114 D3DQK9 D3DQL0 E9PCS0 Q32N02 Q92767
Symbols CD168
IHABP
RHAMM

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Xenopus EggNOG Inparanoid

Gene RIF (52)

PMID Text
26825774 The present study suggests that RHAMM is a novel beta-catenin intracellular binding partner, protecting beta-catenin from degradation and supporting the nuclear translocation of this key cellular mediator
26351067 RHAMM expression identifies an aggressive subpopulation of tumor budding cells and is an independent adverse prognostic factor for colorectal cancer patients.
26247678 In ocular TM cells, our data suggests that the most important determinant of HA cable formation appears to be the ratio of HA chains produced by the different HAS genes.
25830658 a causative link between altered function of AURKA-HMMR-TPX2-TUBG1 and breast carcinogenesis in BRCA1/2 mutation carriers
25731190 RHAMM might be a promising marker to identify early stage (nodal negative) patients at risk for dismal survival, who may benefit from specific adjuvant therapies.
25081535 analysis of the role of growth factors in Hyaluronan/RHAMM interactions in mesenchymal tumor pathogenesis [review]
25042645 stimulation of the E2F1-RHAMM axis in aggressive cancer cells is of high clinical significance
24966934 Case Report: identify patient with cervical cancer expressing three HMMR mRNA variants.
24916930 RHAMM may be implicated in severe ocular surface inflammation affecting the upper tarsal conjunctiva.
24875404 Identify RHAMM as a critical regulator of TPX2 location/ Aurora kinase A signaling and suggest that RHAMM ensures bipolar spindle assembly and mitotic progression through the integration of biochemical and structural pathways.
More...

AA Sequence

MSFPKAPLKRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKSQRFKQQKESKQNLNVDKDTTLPASARKVK      1 - 70
SSESKESQKNDKDLKILEKEIRVLLQERGAQDRRIQDLETELEKMEARLNAALREKTSLSANNATLEKQL     71 - 140
IELTRTNELLKSKFSENGNQKNLRILSLELMKLRNKRETKMRGMMAKQEGMEMKLQVTQRSLEESQGKIA    141 - 210
QLEGKLVSIEKEKIDEKSETEKLLEYIEEISCASDQVEKYKLDIAQLEENLKEKNDEILSLKQSLEENIV    211 - 280
ILSKQVEDLNVKCQLLEKEKEDHVNRNREHNENLNAEMQNLKQKFILEQQEREKLQQKELQIDSLLQQEK    281 - 350
ELSSSLHQKLCSFQEEMVKEKNLFEEELKQTLDELDKLQQKEEQAERLVKQLEEEAKSRAEELKLLEEKL    351 - 420
KGKEAELEKSSAAHTQATLLLQEKYDSMVQSLEDVTAQFESYKALTASEIEDLKLENSSLQEKAAKAGKN    421 - 490
AEDVQHQILATESSNQEYVRMLLDLQTKSALKETEIKEITVSFLQKITDLQNQLKQQEEDFRKQLEDEEG    491 - 560
RKAEKENTTAELTEEINKWRLLYEELYNKTKPFQLQLDAFEVEKQALLNEHGAAQEQLNKIRDSYAKLLG    561 - 630
HQNLKQKIKHVVKLKDENSQLKSEVSKLRCQLAKKKQSETKLQEELNKVLGIKHFDPSKAFHHESKENFA    631 - 700
LKTPLKEGNTNCYRAPMECQESWK                                                  701 - 724
//

Text Mined References (77)

PMID Year Title
26825774 2016 Receptor for hyaluronic acid- mediated motility (RHAMM) regulates HT1080 fibrosarcoma cell proliferation via a ?-catenin/c-myc signaling axis.
26351067 2015 Expression of the hyaluronan-mediated motility receptor RHAMM in tumor budding cells identifies aggressive colorectal cancers.
26247678 2015 Hyaluronan cable formation by ocular trabecular meshwork cells.
25830658 2015 Assessing associations between the AURKA-HMMR-TPX2-TUBG1 functional module and breast cancer risk in BRCA1/2 mutation carriers.
25731190 2015 Receptor for hyaluronic acid-mediated motility (RHAMM, CD168) expression is prognostically important in both nodal negative and nodal positive large cell lung cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25081535 2014 Hyaluronan/RHAMM interactions in mesenchymal tumor pathogenesis: role of growth factors.
25042645 2014 Association of RHAMM with E2F1 promotes tumour cell extravasation by transcriptional up-regulation of fibronectin.
24966934 2014 A case of cervical cancer expressed three mRNA variant of Hyaluronan-mediated motility receptor.
24916930 2014 CD44 and RHAMM hyaluronan receptors in human ocular surface inflammation.
More...