Property Summary

NCBI Gene PubMed Count 76
PubMed Score 208.13
PubTator Score 154.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2499 4.305 2.2
Disease Target Count
Familial cancer of breast 12

Expression

  Differential Expression (30)

Disease log2 FC p
adrenocortical carcinoma 3.189 1.2e-05
adult high grade glioma 2.100 1.1e-04
Atopic dermatitis 2.100 1.8e-04
atypical teratoid / rhabdoid tumor 3.300 5.8e-10
Breast cancer 2.700 2.4e-02
breast carcinoma 1.700 3.4e-06
colon cancer 1.100 1.5e-02
ductal carcinoma in situ 2.800 8.9e-04
Endometriosis 1.370 1.1e-02
ependymoma 1.700 3.9e-06
esophageal adenocarcinoma 1.200 2.0e-02
glioblastoma 2.800 5.1e-09
group 3 medulloblastoma 2.900 4.8e-07
interstitial cystitis 1.600 9.4e-03
intraductal papillary-mucinous carcinoma... 3.700 3.1e-04
intraductal papillary-mucinous neoplasm ... 4.600 1.4e-03
invasive ductal carcinoma 3.000 3.6e-04
lung adenocarcinoma 1.100 3.2e-08
lung cancer 2.100 7.2e-05
malignant mesothelioma 1.500 3.6e-07
medulloblastoma, large-cell 3.600 7.6e-08
nasopharyngeal carcinoma 1.500 4.1e-04
non-small cell lung cancer 2.658 1.4e-29
ovarian cancer 2.500 6.5e-05
pancreatic cancer 1.300 2.8e-02
pancreatic carcinoma 1.300 2.8e-02
primary Sjogren syndrome 1.600 1.1e-04
primitive neuroectodermal tumor 3.300 2.7e-06
psoriasis 1.400 2.3e-24
ulcerative colitis 1.300 4.1e-04

 IMPC Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (56)

AA Sequence

MSFPKAPLKRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKSQRFKQQKESKQNLNVDKDTTLPASARKVK      1 - 70
SSESKESQKNDKDLKILEKEIRVLLQERGAQDRRIQDLETELEKMEARLNAALREKTSLSANNATLEKQL     71 - 140
IELTRTNELLKSKFSENGNQKNLRILSLELMKLRNKRETKMRGMMAKQEGMEMKLQVTQRSLEESQGKIA    141 - 210
QLEGKLVSIEKEKIDEKSETEKLLEYIEEISCASDQVEKYKLDIAQLEENLKEKNDEILSLKQSLEENIV    211 - 280
ILSKQVEDLNVKCQLLEKEKEDHVNRNREHNENLNAEMQNLKQKFILEQQEREKLQQKELQIDSLLQQEK    281 - 350
ELSSSLHQKLCSFQEEMVKEKNLFEEELKQTLDELDKLQQKEEQAERLVKQLEEEAKSRAEELKLLEEKL    351 - 420
KGKEAELEKSSAAHTQATLLLQEKYDSMVQSLEDVTAQFESYKALTASEIEDLKLENSSLQEKAAKAGKN    421 - 490
AEDVQHQILATESSNQEYVRMLLDLQTKSALKETEIKEITVSFLQKITDLQNQLKQQEEDFRKQLEDEEG    491 - 560
RKAEKENTTAELTEEINKWRLLYEELYNKTKPFQLQLDAFEVEKQALLNEHGAAQEQLNKIRDSYAKLLG    561 - 630
HQNLKQKIKHVVKLKDENSQLKSEVSKLRCQLAKKKQSETKLQEELNKVLGIKHFDPSKAFHHESKENFA    631 - 700
LKTPLKEGNTNCYRAPMECQESWK                                                  701 - 724
//

Text Mined References (82)

PMID Year Title