Property Summary

NCBI Gene PubMed Count 13
PubMed Score 202.27
PubTator Score 16.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.200 1.2e-02
atypical teratoid / rhabdoid tumor -1.700 2.2e-06
lung cancer -1.300 1.1e-03
malignant mesothelioma 1.200 1.3e-06
medulloblastoma, large-cell -1.900 8.2e-05
Pick disease -1.300 2.8e-05
primitive neuroectodermal tumor -1.300 2.3e-04
ulcerative colitis 1.700 1.3e-06

AA Sequence

MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGP      1 - 70
CVERKAKLMTPNGPEVHG                                                         71 - 88
//

Text Mined References (16)

PMID Year Title