Property Summary

NCBI Gene PubMed Count 12
PubMed Score 18.65
PubTator Score 15.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.500 0.000
primary Sjogren syndrome 1.100 0.009

Synonym

Accession O75319 B2RCT8 Q6AI47 Q9BWE3
Symbols PIR1

Gene

PANTHER Protein Class (2)

PDB

4JMJ   4MBB   4NYH  

Gene RIF (3)

PMID Text
24447265 the atomic structure of a catalytically inactive mutant (C152S) of the human PIR1 phosphatase core (PIR1-core, residues 29-205), refined at 1.20 A resolution.
19460752 Knockdown of dual specificity phosphatase 11 (RNA/RNP complex 1-interacting, DUSP11) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19120688 results suggest that DUSP11 contributes to p53-dependent inhibition of cell proliferation and that it might be involved in regulating RNA splicing through SAM68

AA Sequence

MSQWHHPRSGWGRRRDFSGRSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEEC      1 - 70
FSPLDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETVPYLKIFTVGHQVPDDETIFKFKHAVNGFLKE     71 - 140
NKDNDKLIGVHCTHGLNRTGYLICRYLIDVEGVRPDDAIELFNRCRGHCLERQNYIEDLQNGPIRKNWNS    141 - 210
SVPRSSDFEDSAHLMQPVHNKPVKQGPRYNLHQIQGHSAPRHFHTQTQSLQQSVRKFSENPHVYQRHHLP    211 - 280
PPGPPGEDYSHRRYSWNVKPNASRAAQDRRRWYPYNYSRLSYPACWEWTQ                        281 - 330
//

Text Mined References (16)

PMID Year Title
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
24447265 2014 Structure of human PIR1, an atypical dual-specificity phosphatase.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21931564 2011 A genome-wide metabolic QTL analysis in Europeans implicates two loci shaped by recent positive selection.
20383145 2010 Genetic loci influencing kidney function and chronic kidney disease.
19120688 2009 Isolation and characterization of DUSP11, a novel p53 target gene.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15635413 2005 Nucleolar proteome dynamics.
More...