Property Summary

NCBI Gene PubMed Count 19
PubMed Score 11.63
PubTator Score 7.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.400 3.1e-04
astrocytic glioma -1.200 1.0e-02
atypical teratoid / rhabdoid tumor -1.700 5.6e-08
ependymoma -1.200 2.2e-02
glioblastoma -1.100 6.5e-06
group 4 medulloblastoma -1.200 5.3e-04
juvenile dermatomyositis 1.032 8.3e-09
medulloblastoma, large-cell -2.000 2.8e-06
osteosarcoma -1.986 6.4e-05
ovarian cancer -1.500 3.7e-05
primitive neuroectodermal tumor -1.200 1.7e-04

Gene RIF (11)

AA Sequence

MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAY      1 - 70
KSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIADIL     71 - 140
QEERKQEKQNGRLPNGNIDNENNNSTPDPTWVHEIFQGTLTNETRCLTCETISSKDEDFLDLSVDVEQNT    141 - 210
SITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVF    211 - 280
PLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGL    281 - 350
TSDISKNSESGYILFYQSRD                                                      351 - 370
//

Text Mined References (20)

PMID Year Title