Property Summary

NCBI Gene PubMed Count 50
Grant Count 10
R01 Count 7
Funding $747,209
PubMed Score 25.81
PubTator Score 19.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Pathway (1)

Gene RIF (14)

PMID Text
26634697 When the inter-dependence between alleles was examined using conditional models, five loci on BUD13, ZNF259, and ApoA5 showed possible independent associations.
26397108 Single nucleotide polymorphisms (Rs964184, rs3317316, rs6589566) of ZNF259 protein did not increase the risk of CHD in the Chinese population.
26118197 ZNF259 variants were associated with elevated Metabolic Syndrome risk in a Han Chinese population from the Jilin province of Northeastern China
24989072 Significant linkage disequilibria were noted among ZNF259, BUD13 and MLXIPL SNPs and serum lipid levels.
24780069 Single nucleotide polymorphism zinc finger protein 259 gene is associated with hyperlipidaemia.
24688311 These findings suggest that the association between ZNF259 rs2075290 SNP and serum lipid levels might have ethnic- and/or sex-specificity.
24618354 Novel APOA5-ZNF259 haplotype manifesting sex-dependent effects on elevation of the TG:HDL-C ratio as well as the increased risk for metabolic syndrome.
24178511 genetic polymorphism at the loci is associated with Factor VII and fibrinogen levels, and with plasma viscosity
22623978 Significant associations of two SNPs (rs964184 and rs12286037) from ZNF259 with triglyceride levels in an Asian Indian cohort.
20691829 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MAASGAVEPGPPGAAVAPSPAPAPPPAPDHLFRPISAEDEEQQPTEIESLCMNCYCNGMTRLLLTKIPFF      1 - 70
REIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLSVRALEDMNREVVKTDSAATRIPELDFEIPAFSQK     71 - 140
GALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQVASPFTLIIDDPSGNSFVENPHA    141 - 210
PQKDDALVITHYNRTRQQEEMLGLQEEAPAEKPEEEDLRNEVLQFSTNCPECNAPAQTNMKLVQIPHFKE    211 - 280
VIIMATNCENCGHRTNEVKSGGAVEPLGTRITLHITDASDMTRDLLKSETCSVEIPELEFELGMAVLGGK    281 - 350
FTTLEGLLKDIRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAP    351 - 420
EDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR                                   421 - 459
//

Text Mined References (51)

PMID Year Title
26634697 2016 Multiple susceptibility loci at chromosome 11q23.3 are associated with plasma triglyceride in East Asians.
26397108 2015 Effects of Polymorphisms in APOA4-APOA5-ZNF259-BUD13 Gene Cluster on Plasma Levels of Triglycerides and Risk of Coronary Heart Disease in a Chinese Han Population.
26118197 2015 Zinc Finger Protein 259 (ZNF259) Polymorphisms are Associated with the Risk of Metabolic Syndrome in a Han Chinese Population.
25411281 2014 Meta-analysis of genome-wide association studies for circulating phylloquinone concentrations.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
24989072 2014 Association between the MLX interacting protein-like, BUD13 homolog and zinc finger protein 259 gene polymorphisms and serum lipid levels.
24886709 2014 Amerindian-specific regions under positive selection harbour new lipid variants in Latinos.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24780069 2014 Association of the variants in the BUD13-ZNF259 genes and the risk of hyperlipidaemia.
24688311 2014 Sex-specific association of the zinc finger protein 259 rs2075290 polymorphism and serum lipid levels.
More...