Property Summary

NCBI Gene PubMed Count 50
PubMed Score 28.23
PubTator Score 19.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute myeloid leukemia 2.400 3.1e-02
adult high grade glioma -1.700 9.3e-04
astrocytic glioma -1.700 2.7e-02
Astrocytoma, Pilocytic -1.200 8.4e-04
atypical teratoid / rhabdoid tumor -2.800 1.5e-08
diabetes mellitus -1.900 2.6e-02
ependymoma -1.900 1.2e-09
glioblastoma -1.400 4.2e-05
group 3 medulloblastoma -1.200 4.0e-02
lung cancer 1.100 2.0e-03
medulloblastoma, large-cell -2.700 1.5e-04
mucosa-associated lymphoid tissue lympho... -1.099 4.1e-02
non diabetic and post-ischemic heart fai... -1.100 3.6e-02
oligodendroglioma -1.500 4.7e-02
osteosarcoma -1.529 4.3e-05
primitive neuroectodermal tumor -1.300 1.7e-02

Gene RIF (14)

AA Sequence

MAASGAVEPGPPGAAVAPSPAPAPPPAPDHLFRPISAEDEEQQPTEIESLCMNCYCNGMTRLLLTKIPFF      1 - 70
REIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLSVRALEDMNREVVKTDSAATRIPELDFEIPAFSQK     71 - 140
GALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQVASPFTLIIDDPSGNSFVENPHA    141 - 210
PQKDDALVITHYNRTRQQEEMLGLQEEAPAEKPEEEDLRNEVLQFSTNCPECNAPAQTNMKLVQIPHFKE    211 - 280
VIIMATNCENCGHRTNEVKSGGAVEPLGTRITLHITDASDMTRDLLKSETCSVEIPELEFELGMAVLGGK    281 - 350
FTTLEGLLKDIRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAP    351 - 420
EDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR                                   421 - 459
//

Text Mined References (51)

PMID Year Title