Property Summary

Ligand Count 3
NCBI Gene PubMed Count 16
PubMed Score 12.88
PubTator Score 22.08

Knowledge Summary

Patent (1,064)

Expression

  Differential Expression (4)

Disease log2 FC p
inflammatory breast cancer -1.100 1.6e-02
non primary Sjogren syndrome sicca -1.100 2.7e-02
pituitary cancer 1.700 4.8e-04
psoriasis -1.200 3.3e-06

Gene RIF (9)

AA Sequence

MAHVRHFRTLVSGFYFWEAALLLSLVATKETDSARSRSAPMSPSDFLDKLMGRTSGYDARIRPNFKGPPV      1 - 70
NVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGAN     71 - 140
FHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQ    141 - 210
VAEGLTLPQFLLKEEKDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMD    211 - 280
AAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRF    281 - 350
RRKRKNKTEAFALEKFYRFSDMDDEVRESRFSFTAYGMGPCLQAKDGMTPKGPNHPVQVMPKSPDEMRKV    351 - 420
FIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRHEDIHQQQD                              421 - 464
//

Text Mined References (16)

PMID Year Title