Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.17
PubTator Score 22.08

Knowledge Summary

Patent (1,064)

Expression

  Differential Expression (4)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.100 0.027
inflammatory breast cancer -1.100 0.016
pituitary cancer 1.700 0.000
psoriasis -1.200 0.000

Gene RIF (7)

PMID Text
26416729 3.0 A X-ray structure of the human glycine receptor-alpha3 homopentamer in complex with a high affinity, high-specificity antagonist, strychnine
23834509 Protein kinase (PK)A-dependent phosphorylation of alpha3 GlyRs produces a conformational change that propagates to the glycine-binding site.
19959465 Results indicate that the multifunctional basic motif of the TM3-4 loop is capable of mediating a karyopherin-dependent intracellular sorting of full-length GlyRs.
19661067 the spliced insert within the large TM 3-4 loop of alpha3 Gly receptors serves to stabilize the overall spatial structure of the domain, and present a control unit that regulates gating of the receptor ion channel
19086053 Observational study of gene-disease association. (HuGE Navigator)
11496371 Observational study of gene-disease association. (HuGE Navigator)
7894176 Determines location of mouse glycine alpha 3.

AA Sequence

MAHVRHFRTLVSGFYFWEAALLLSLVATKETDSARSRSAPMSPSDFLDKLMGRTSGYDARIRPNFKGPPV      1 - 70
NVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGAN     71 - 140
FHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQ    141 - 210
VAEGLTLPQFLLKEEKDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMD    211 - 280
AAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRF    281 - 350
RRKRKNKTEAFALEKFYRFSDMDDEVRESRFSFTAYGMGPCLQAKDGMTPKGPNHPVQVMPKSPDEMRKV    351 - 420
FIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRHEDIHQQQD                              421 - 464
//

Text Mined References (14)

PMID Year Title
26416729 2015 Crystal structure of human glycine receptor-?3 bound to antagonist strychnine.
24595857 2014 Genome-wide association study of urinary albumin excretion rate in patients with type 1 diabetes.
23834509 2013 Phosphorylation of ?3 glycine receptors induces a conformational change in the glycine-binding site.
19959465 2010 Multifunctional basic motif in the glycine receptor intracellular domain induces subunit-specific sorting.
19661067 2009 Novel regulatory site within the TM3-4 loop of human recombinant alpha3 glycine receptors determines channel gating and domain structure.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12358726 2002 Hydroxylated residues influence desensitization behaviour of recombinant alpha3 glycine receptor channels.
More...