Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.75
PubTator Score 5.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Fascioliasis 18 3.735 1.9
psoriasis 6,685

Synonym

Accession O75310 Q3KNV9 UDPGT 2B11
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
26238215 CYP3A4, CYP3A7, UGT2B11 and UGT2B15 genes are significantly downregulated in melanosis coli.
21679149 significant expression of UGT2B11 was detected in the liver, breast and kidney, and was clearly different from the distribution of UGT2B28
20214802 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTLKWTSVLLLIHLSCYFSSGSCGKVLVWAAEYSHWMNMKTILKELVQRGHEVTVLASSASILFDPNDAS      1 - 70
TLKFEVYPTSLTKTEFENIIMQQVKRWSDIRKDSFWLYFSQEQEILWELYDIFRNFCKDVVSNKKVMKKL     71 - 140
QESRFDIVFADAVFPCGELLAALLNIRFVYSLRFTPGYTIERHSGGLIFPPSYIPIVMSKLSDQMTFMER    141 - 210
VKNMIYVLYFDFWFQMSDMKKWDQFYSEVLGRPTTLFETMGKADIWLMRNSWSFQFPHPFLPNVDFVGGF    211 - 280
HCKPAKPLPKEMEEFVQSSGENGVVVFSLGSVISNMTAERANVIATALAKIPQKVLWRFDGNKPDALGLN    281 - 350
TRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRLDFNTM    351 - 420
SSTDLLNALKTVINDPLYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMPHKGAKHLRVAAHDLTWFQYHS    421 - 490
LDVIGFLLACVATVIFIITKFCLFCFWKFARKGKKGKRD                                   491 - 529
//

Text Mined References (10)

PMID Year Title
26238215 2015 Histopathology of melanosis coli and determination of its associated genes by comparative analysis of expression microarrays.
21679149 2011 Quantitative analysis of UGT2B28 mRNA expression by real-time RT-PCR and application to human tissue distribution study.
20214802 2010 Genetic variation in the estrogen metabolic pathway and mammographic density as an intermediate phenotype of breast cancer.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
9675083 1998 Isolation and characterization of a human orphan UDP-glucuronosyltransferase, UGT2B11.
8333863 1993 cDNA cloning and expression of two new members of the human liver UDP-glucuronosyltransferase 2B subfamily.