Property Summary

NCBI Gene PubMed Count 16
Grant Count 60
R01 Count 28
Funding $7,354,879.29
PubMed Score 10.35
PubTator Score 5.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group B ependymoma -2.400 0.000
astrocytoma -1.200 0.000
glioblastoma -1.500 0.000
oligodendroglioma -1.200 0.000
pediatric high grade glioma -1.500 0.000
atypical teratoid/rhabdoid tumor -1.200 0.000
pilocytic astrocytoma -1.700 0.000

Synonym

Accession O75298 O60509 Q7RTM6 Q7RTN1 Q7RTN2
Symbols NSP2
NSPL1
NSPLI
SPG12

Gene

PANTHER Protein Class (1)

Gene RIF (5)

PMID Text
22232211 Results implicate reticulon 2 in axonopathy, show that this protein participates in a network of interactions among hereditary spastic paraplegia proteins involved in endoplasmic reticulum shaping.
19720795 sk-NSPl1 is a novel dantrolene receptor that plays an important role in membrane translocation of GLUT4 induced by contraction/exercise. The 23-kDa sk-NSPl1 may also be involved in the regulation of glucose levels in the whole body.
18187620 Knockdown of reticulon 2 (RTN2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18096700 RTN2B functions as a positive regulator in the delivery of EAAC1 from the ER to the cell surface.
9530622 Discusses cloning of mouse neuroendocrine-specific protein-like 1, in addition to partial cloning of the human ortholog. Also studies expression of both the mouse and human genes.

AA Sequence

MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEETTSQDWGTPRELTFSYIAFD      1 - 70
GVVGSGGRRDSTARRPRPQGRSVSEPRDQHPQPSLGDSLESIPSLSQSPEPGRRGDPDTAPPSERPLEDL     71 - 140
RLRLDHLGWVARGTGSGEDSSTSSSTPLEDEEPQEPNRLETGEAGEELDLRLRLAQPSSPEVLTPQLSPG    141 - 210
SGTPQAGTPSPSRSRDSNSGPEEPLLEEEEKQWGPLEREPVRGQCLDSTDQLEFTVEPRLLGTAMEWLKT    211 - 280
SLLLAVYKTVPILELSPPLWTAIGWVQRGPTPPTPVLRVLLKWAKSPRSSGVPSLSLGADMGSKVADLLY    281 - 350
WKDTRTSGVVFTGLMVSLLCLLHFSIVSVAAHLALLLLCGTISLRVYRKVLQAVHRGDGANPFQAYLDVD    351 - 420
LTLTREQTERLSHQITSRVVSAATQLRHFFLVEDLVDSLKLALLFYILTFVGAIFNGLTLLILGVIGLFT    421 - 490
IPLLYRQHQAQIDQYVGLVTNQLSHIKAKIRAKIPGTGALASAAAAVSGSKAKAE                   491 - 545
//

Text Mined References (16)

PMID Year Title
25612671 2014 Identification and characterization of TMEM33 as a reticulon-binding protein.
22232211 2012 Mutations in the ER-shaping protein reticulon 2 cause the axon-degenerative disorder hereditary spastic paraplegia type 12.
21269460 2011 Initial characterization of the human central proteome.
19720795 2009 Functional role of neuroendocrine-specific protein-like 1 in membrane translocation of GLUT4.
18096700 2008 Reticulon RTN2B regulates trafficking and function of neuronal glutamate transporter EAAC1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15286784 2004 Reticulon family members modulate BACE1 activity and amyloid-beta peptide generation.
12832288 2003 A reticular rhapsody: phylogenic evolution and nomenclature of the RTN/Nogo gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...