Property Summary

NCBI Gene PubMed Count 49
Grant Count 91
R01 Count 59
Funding $6,214,208.39
PubMed Score 178.13
PubTator Score 75.24

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O75293 A8KAM2 O75960 Q17R46
Symbols MYD118
GADD45BETA

Gene

 GO Component (2)

Gene RIF (28)

PMID Text
24104474 Gadd45B protects the liver through two entirely different processes: binding MKK7 to block damaging signal transduction or binding CAR to coactivate anabolic transcription. (Review)
24104471 The gadd45b gene has both tumor suppressor and tumor promoter functions, dependent on the tissue/cell type and transforming event. (Review)
23110778 as such may play an unappreciated role in tumorigenesis. The exact mechanism of GADD45B inactivation and overexpression requires further investigation. GADD45B could be a potential therapeutic target for CRC treatment in future
22096849 Cadmium chloride can induce DNA damage and increase expression levels of the gadd153 and gadd45beta promoters in HepG2 cells.
22048458 finding show there is an increased expression and decreased promoter binding of GADD45b in psychotic subjects.
21810943 GADD45beta is a novel pituitary tumor suppressor whose reexpression blocks proliferation, survival, and tumorigenesis
21127053 PXR activates the GADD45beta gene, increasing p38 MAPK phosphorylation, and leading HepG2 cells to change morphology and migrate.
21062976 Findings suggest that GADD45beta induction contributes to sorafenib-induced apoptosis in HCC cells, prompting further studies to validate its potential value in predicting sorafenib efficacy.
20942912 The association of GADD45beta expression and pathological grading of chondrosarcoma in the present study suggests that the immunohistochemical study of GADD45beta may be a specific diagnostic parameter for chondrosarcoma cell differentiation.
20558744 Findings suggest that Gadd45b mediates p38-induced Rb phosphorylation by enhancing the interaction between p38 and Rb during Fas-induced apoptosis in murine hepatocytes.
More...

AA Sequence

MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIA      1 - 70
LQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVAS     71 - 140
YCEESRGNNQWVPYISLQER                                                      141 - 160
//

Text Mined References (50)

PMID Year Title
25314077 2014 Cancer-selective targeting of the NF-?B survival pathway with GADD45?/MKK7 inhibitors.
24104474 2013 Gadd45 in the liver: signal transduction and transcriptional mechanisms.
24104471 2013 Gadd45 in modulation of solid tumors and leukemia.
23110778 2012 Abnormal expression of GADD45B in human colorectal carcinoma.
22096849 2011 [The effects of the cadmium chloride on the DNA damage and the expression level of gadd gene in HepG2 cell line].
22048458 2012 Growth arrest and DNA-damage-inducible, beta (GADD45b)-mediated DNA demethylation in major psychosis.
21810943 2011 Identification of growth arrest and DNA-damage-inducible gene beta (GADD45beta) as a novel tumor suppressor in pituitary gonadotrope tumors.
21127053 2011 Pregnane X receptor PXR activates the GADD45beta gene, eliciting the p38 MAPK signal and cell migration.
21062976 2010 Induction of DNA damage-inducible gene GADD45beta contributes to sorafenib-induced apoptosis in hepatocellular carcinoma cells.
20942912 2010 Gadd45? expression in chondrosarcoma: a pilot study for diagnostic and biological implications in histological grading.
More...