Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 3.16051615810447E-7
tuberculosis and treatment for 6 months 686 9.47141909134867E-5
group 4 medulloblastoma 1875 2.047163284857E-4
osteosarcoma 7933 0.00116348533585428
hepatocellular carcinoma 550 0.00275692269669703
primary Sjogren syndrome 789 0.0075775823271092
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (6)

Disease log2 FC p
hepatocellular carcinoma 1.500 0.003
osteosarcoma -1.102 0.001
group 4 medulloblastoma 1.600 0.000
tuberculosis and treatment for 6 months -1.200 0.000
primary Sjogren syndrome 1.100 0.008
ovarian cancer -1.100 0.000

Synonym

Accession O75290 E9PB48 Q6ZN87
Symbols ZNF780

Gene

  Ortholog (3)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG

Pathway (1)

AA Sequence

MVHGSVTFRDVAIDFSQEEWECLQPDQRTLYRDVMLENYSHLISLGSSISKPDVITLLEQEKEPWMVVRK      1 - 70
ETSRRYPDLELKYGPEKVSPENDTSEVNLPKQVIKQISTTLGIEAFYFRNDSEYRQFEGLQGYQEGNINQ     71 - 140
KMISYEKLPTHTPHASLICNTHKPYECKECGKYFSRSANLIQHQSIHTGEKPFECKECGKAFRLHIQFTR    141 - 210
HQKFHTGEKPFECNECGKAFSLLTLLNRHKNIHTGEKLFECKECGKSFNRSSNLVQHQSIHSGVKPYECK    211 - 280
ECGKGFNRGAHLIQHQKIHSNEKPFVCKECGMAFRYHYQLIEHCQIHTGEKPFECKECGKAFTLLTKLVR    281 - 350
HQKIHTGEKPFECRECGKAFSLLNQLNRHKNIHTGEKPFECKECGKSFNRSSNLVQHQSIHAGIKPYECK    351 - 420
ECGKGFNRGAHLIQHQKIHSNEKPFVCRECEMAFRYHCQLIEHSRIHTGDKPFECQDCGKAFNRGSSLVQ    421 - 490
HQSIHTGEKPYECKECGKAFRLYLQLSQHQKTHTGEKPFECKECGKFFRRGSNLNQHRSIHTGKKPFECK    491 - 560
ECGKAFRLHMHLIRHQKLHTGEKPFECKECGKAFRLHMQLIRHQKLHTGEKPFECKECGKVFSLPTQLNR    561 - 630
HKNIHTGEKAS                                                               631 - 641
//

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.