Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
group 4 medulloblastoma 1875 1.36874786201599E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 6.57994586294972E-6
osteosarcoma 7933 1.15886429628582E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00551248889763484
active ulcerative colitis 477 0.0170122120041012
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0228813496066088
Endometriosis 535 0.0305172566371485

Expression

Synonym

Accession O75264 B9EJF4 Q9P059
Symbols MARDI
HSPC323
C19orf77

Gene

  Ortholog (4)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG

AA Sequence

METLGALLVLEFLLLSPVEAQQATEHRLKPWLVGLAAVVGFLFIVYLVLLANRLWCSKARAEDEEETTFR      1 - 70
MESNLYQDQSEDKREKKEAKEKEEKRKKEKKTAKEGESNLGLDLEEKEPGDHERAKSTVM               71 - 130
//

Text Mined References (7)

PMID Year Title
27288013 2016 MAP17 Is a Necessary Activator of Renal Na+/Glucose Cotransporter SGLT2.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.