Property Summary

Ligand Count 1
NCBI Gene PubMed Count 23
PubMed Score 793.42
PubTator Score 135.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.200 2.4e-02
Multiple myeloma 1.431 6.1e-03
non primary Sjogren syndrome sicca 1.100 2.6e-02
ovarian cancer 1.600 6.0e-05
pancreatic ductal adenocarcinoma liver m... -1.239 1.9e-02

Gene RIF (9)

AA Sequence

MAVLSAPGLRGFRILGLRSSVGPAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRGEYVVAKLDDL      1 - 70
VNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQ     71 - 140
MPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIW    141 - 210
YRR                                                                       211 - 213
//

Text Mined References (26)

PMID Year Title