Property Summary

NCBI Gene PubMed Count 23
Grant Count 8
R01 Count 6
Funding $2,657,763.67
PubMed Score 720.08
PubTator Score 135.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.431 0.006
pancreatic ductal adenocarcinoma liver m... -1.239 0.019
diabetes mellitus -1.200 0.024
non primary Sjogren syndrome sicca 1.100 0.026
ovarian cancer 1.600 0.000

Gene RIF (8)

PMID Text
22935918 no active role of NDUFS7 gene in schizophrenia, was found.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of NADH dehydrogenase (ubiquinone) Fe-S protein 7 (NADH-coenzyme Q reductase; NDUFS7) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18435906 Both the amount and intrinsic activity of complex I are decreased in inherited complex I deficiency, ehich can be increased by Trolox.
17604671 Intronic NDUFS7 gene mutation is associated with activation of a cryptic exon and impaired assembly of mitochondrial complex I in a patient with Leigh syndrome
17601350 Observational study of gene-disease association. (HuGE Navigator)
17275378 A patient with Leigh syndrome (LS), born to consanguineous parents, with severe complex I defect and a novel mutation in the NDUFS7 gene subunit.

AA Sequence

MAVLSAPGLRGFRILGLRSSVGPAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRGEYVVAKLDDL      1 - 70
VNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQ     71 - 140
MPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIW    141 - 210
YRR                                                                       211 - 213
//

Text Mined References (26)

PMID Year Title
27226634 2016 NDUFAF5 Hydroxylates NDUFS7 at an Early Stage in the Assembly of Human Complex I.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22935918 2013 No association between genetic polymorphisms of the NDUFS7 gene and schizophrenia in Han Chinese.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18435906 Mitigation of NADH: ubiquinone oxidoreductase deficiency by chronic Trolox treatment.
17604671 A novel mutation of the NDUFS7 gene leads to activation of a cryptic exon and impaired assembly of mitochondrial complex I in a patient with Leigh syndrome.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17275378 2007 A novel mutation in the human complex I NDUFS7 subunit associated with Leigh syndrome.
More...