Property Summary

NCBI Gene PubMed Count 121
PubMed Score 406.69
PubTator Score 448.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
psoriasis 6685 3.12436441374421E-22
pituitary cancer 1972 1.64456931774929E-21
lung carcinoma 2844 1.27277794969427E-14
breast carcinoma 1614 3.80839327292526E-12
juvenile dermatomyositis 1189 6.29773837374177E-12
non-inflammatory breast cancer 208 3.83164284591403E-8
lung cancer 4473 4.46558759439591E-8
intraductal papillary-mucinous adenoma (IPMA) 2956 5.02072106602554E-6
invasive ductal carcinoma 2950 1.45277200037442E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.48470759539867E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.76687841412934E-4
atypical teratoid / rhabdoid tumor 4369 4.42768728283077E-4
primitive neuroectodermal tumor 3031 7.48311483440964E-4
Duchenne muscular dystrophy 602 0.00194133645936658
medulloblastoma, large-cell 6234 0.00274012633855445
Amyotrophic Lateral Sclerosis 432 0.00460114578384178
pancreatic cancer 2300 0.00582952425509003
dermatomyositis 967 0.0120644122352827
interstitial cystitis 2299 0.0161488638429788
glioblastoma 5572 0.0225422559257851
type II diabetes mellitus and post-ischemic heart failure 89 0.023246971243709
pediatric high grade glioma 2712 0.0341601068149584
Disease Target Count Z-score Confidence
Eye and adnexa disease 11 0.0 1.0
Disease Target Count Z-score Confidence
Obesity 616 3.702 1.9
Cancer 2346 3.646 1.8
Silver-Russell syndrome 37 3.107 1.6

Expression

Synonym

Accession P80370 P15803 Q96DW5 DLK-1
Symbols DLK
FA1
ZOG
pG2
DLK-1
PREF1
Delta1
Pref-1

Gene

  Ortholog (12)

Gene RIF (77)

PMID Text
26754526 Results suggest a potential signalling hierarchy between Delta-like 1 and ephrin-B2 ligands, as neural stem cells adopt the Delta-like 1 phenotype of stem cell maintenance on simultaneous presentation of both signals.
26115479 DLK1 expression diminishes during differentiation of human U937 cells to macrophages.
26018510 Kaplan-Meier analysis indicated that higher DLK1 levels were associated with shorter survival in Hepatocellular carcinoma (HCC) patients. These results suggest that the serum levels of DLK1 may serve as a prognostic biomarker for HCC patients.
25918019 These mice show improved glucose tolerance. Taken together, we conclude Pref-1 as a positive regulator of islet beta-cells and insulin production.
25559145 Notch pathway activation in endothelial colony forming cells in vivo via co-implanted stromal cells expressing delta-like 1 promotes vasculogenesis.
25461394 Data show that preadipocyte factor 1 Pref-1 is probably not a major contributor to gestational diabetes mellitus (GDM) pathophysiology but might directly contribute to triglycerides (TG) metabolism, as well as depend on gestational age and renal function.
25449367 Serum levels of Pref-1 were associated with the amount of alcohol consumed during the past 30 days.
25351781 The results indicate the occurrence of epimutation affecting the IG-DMR and the MEG3-DMR in the two cases, and imply that UPD(14)mat and related (epi)genetic aberrations constitute a rare but important underlying factor for Silver-Russell Syndrome
24908673 DLK1, INSL3 and COUP-TFII expression changes during normal development and is linked to different stages of Leydig Cell differentiation.
24844362 Data show that the median expression of Jagged-1 protein and delta-like 1 protein (Dll-1) was significantly higher in acute myeloid leukemia (AML) blasts than in peripheral blood stem cells (PBSCs).
More...

AA Sequence

MTATEALLRVLLLLLAFGHSTYGAECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGE      1 - 70
PGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQH     71 - 140
GGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVT    141 - 210
NCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQP    211 - 280
EHRILKVSMKELNKKTPLLTEGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLL    281 - 350
LQYNSGEDLAVNIIFPEKIDMTTFSKEAGDEEI                                         351 - 383
//

Text Mined References (123)

PMID Year Title
26754526 2016 Interrogating cellular fate decisions with high-throughput arrays of multiplexed cellular communities.
26115479 2015 DLK1 is a novel inflammatory inhibitor which interferes with NOTCH1 signaling in TLR-activated murine macrophages.
26018510 2015 Serum DLK1 is a potential prognostic biomarker in patients with hepatocellular carcinoma.
25918019 2015 Overexpression of Pref-1 in pancreatic islet ?-cells in mice causes hyperinsulinemia with increased islet mass and insulin secretion.
25559145 2015 Notch ligand Delta-like 1 promotes in vivo vasculogenesis in human cord blood-derived endothelial colony forming cells.
25461394 2015 Serum levels of the adipokine Pref-1 in gestational diabetes mellitus.
25449367 2014 Increasing serum pre-adipocyte factor-1 (Pref-1) correlates with decreased body fat, increased free fatty acids, and level of recent alcohol consumption in excessive alcohol drinkers.
25351781 2015 Epimutations of the IG-DMR and the MEG3-DMR at the 14q32.2 imprinted region in two patients with Silver-Russell Syndrome-compatible phenotype.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25093684 2014 The proteins DLK1 and DLK2 modulate NOTCH1-dependent proliferation and oncogenic potential of human SK-MEL-2 melanoma cells.
More...