Property Summary

NCBI Gene PubMed Count 27
PubMed Score 142.51
PubTator Score 117.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.100 4.2e-02
Breast cancer 1.100 2.1e-05
breast carcinoma 1.100 3.4e-28
ductal carcinoma in situ 1.600 4.7e-04
invasive ductal carcinoma 1.600 1.9e-02
lung adenocarcinoma 1.100 9.0e-09
lung cancer 1.700 3.8e-04
Multiple myeloma 1.407 1.9e-03
nasopharyngeal carcinoma 1.100 7.3e-05
non-small cell lung cancer 1.543 4.3e-25
ovarian cancer 1.900 1.4e-03
Pick disease -1.200 1.7e-05
psoriasis 2.100 7.6e-05
subependymal giant cell astrocytoma 1.618 4.0e-02
Waldenstrons macroglobulinemia 1.257 2.3e-02

Synonym

Accession O75223 B2RDN0 B8ZZN4 B8ZZR8 Q9BS37
Symbols GGC
GCTG
CRF21
C7orf24

Gene

PDB

2I5T   2PN7   2Q53   2RBH   3CRY  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (15)

AA Sequence

MANSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIAT      1 - 70
IFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYK     71 - 140
KIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKKGETQTL                          141 - 188
//

Text Mined References (29)

PMID Year Title