Property Summary

NCBI Gene PubMed Count 27
Grant Count 1
Funding $129,338.5
PubMed Score 135.04
PubTator Score 117.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.257 0.023
Multiple myeloma 1.407 0.002
astrocytic glioma -1.100 0.042
psoriasis 2.100 0.000
non-small cell lung cancer 1.543 0.000
lung cancer 1.700 0.000
subependymal giant cell astrocytoma 1.618 0.040
lung adenocarcinoma 1.424 0.000
nasopharyngeal carcinoma 1.100 0.000
non-inflammatory breast cancer 1.200 0.018
breast carcinoma 1.100 0.000
Pick disease -1.200 0.000
ductal carcinoma in situ 1.600 0.000
invasive ductal carcinoma 1.600 0.019
ovarian cancer 1.900 0.001

Synonym

Accession O75223 B2RDN0 B8ZZN4 B8ZZR8 Q9BS37
Symbols GGC
GCTG
CRF21
C7orf24

Gene

 Grant Application (1)

PDB

2I5T   2PN7   2Q53   2RBH   3CRY  

Gene RIF (15)

PMID Text
26828272 GGCT plays a critical role in glioma cell proliferation and may be a potential cancer therapeutic target.
26339607 GGCT is promising as a diagnostic marker and a therapeutic target for various cancers. This review summarizes these interesting findings.
25941902 GGCT plays a critical role in lung cancer cell proliferation.
25818003 G6PD, GGCT, IDH1, isocitrate dehydrogenase 2 (NADP+,mitochondrial) (IDH2) and glutathione S-transferase pi 1(GSTP1), five of the critical components of GSH pathway, contribute to chemoresistance.
24342434 increased expression of GGCT was a common event among invasive esophageal squamous cell carcinoma tissues regardless of the depth of invasion. Lymph node metastasis and tumor differentiation correlated with GGCT expression
23853312 Transcriptional silencing of the C7orf24 gene in the non-malignant cells is elicited through heterochromatin formation in its promoter region.
23513927 C7orf24 has been recognized as a potent marker for bladder and breast cancers. Studies on the role of gamma-glutamylcyclotransferace may aid in the control of malignant transformation of these cancers.
22205682 GGCT may be a biomarker of tumors in a limited range of organs.
20527979 C7orf24 overexpression defines a subgroup of breast tumors with poor clinical outcome.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MANSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIAT      1 - 70
IFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYK     71 - 140
KIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKKGETQTL                          141 - 188
//

Text Mined References (29)

PMID Year Title
27658708 2016 Depletion of ?-glutamylcyclotransferase inhibits breast cancer cell growth via cellular senescence induction mediated by CDK inhibitor upregulation.
26828272 2016 Gamma-glutamylcyclotransferase promotes the growth of human glioma cells by activating Notch-Akt signaling.
26339607 2015 Gamma-Glutamylcyclotransferase: A Novel Target Molecule for Cancer Diagnosis and Treatment.
25941902 2015 ?-Glutamylcyclotransferase Knockdown Inhibits Growth of Lung Cancer Cells Through G0/G1 Phase Arrest.
25818003 2015 Identification of proteins responsible for adriamycin resistance in breast cancer cells using proteomics analysis.
24342434 2014 ?-Glutamylcyclotransferase as a novel immunohistochemical biomarker for the malignancy of esophageal squamous tumors.
23853312 2013 Association of epigenetic alterations in the human C7orf24 gene with the aberrant gene expression in malignant cells.
23513927 2012 [C7orf24/gamma-glutamyl cyclotransferase as a molecular target for cancer chemotherapy].
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22205682 2012 Widespread expression of ?-glutamyl cyclotransferase suggests it is not a general tumor marker.
More...