Property Summary

NCBI Gene PubMed Count 14
PubMed Score 101.87
PubTator Score 26.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
COENZYME Q10 DEFICIENCY, PRIMARY, 5 1 0.0 0.0
Disease Target Count
COENZYME Q10 DEFICIENCY, PRIMARY, 1 6
Disease Target Count P-value
ovarian cancer 8519 2.0e-06
osteosarcoma 7950 9.3e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Coenzyme Q10 deficiency disease 8 5.309 2.7
Disease Target Count Z-score Confidence
Multiple acyl-CoA dehydrogenase deficiency 25 3.971 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.262 9.3e-05
ovarian cancer -1.100 2.0e-06

Gene RIF (3)

AA Sequence

MAAAAVSGALGRAGWRLLQLRCLPVARCRQALVPRAFHASAVGLRSSDEQKQQPPNSFSQQHSETQGAEK      1 - 70
PDPESSHSPPRYTDQGGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGK     71 - 140
DGSELILHFVTQCNTRLTRVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILMLP    141 - 210
HNIPSSLSLLTSMVDDMWHYAGDQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDA    211 - 280
MNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR                                    281 - 318
//

Text Mined References (16)

PMID Year Title