Property Summary

NCBI Gene PubMed Count 21
PubMed Score 19.46
PubTator Score 20.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer -1.500 3.2e-02
osteosarcoma -1.796 8.0e-07
ovarian cancer 1.200 2.5e-05
psoriasis -1.900 1.9e-05

Gene RIF (15)

AA Sequence

MYAPGGAGLPGGRRRRSPGGSALPKQPERSLASALPGALSITALCTALAEPAWLHIHGGTCSRQELGVSD      1 - 70
VLGYVHPDLLKDFCMNPQTVLLLRVIAAFCFLGILCSLSAFLLDVFGPKHPALKITRRYAFAHILTVLQC     71 - 140
ATVIGFSYWASELILAQQQQHKKYHGSQVYVTFAVSFYLVAGAGGASILATAANLLRHYPTEEEEQALEL    141 - 210
LSEMEENEPYPAEYEVINQFQPPPAYTP                                              211 - 238
//

Text Mined References (24)

PMID Year Title