Property Summary

NCBI Gene PubMed Count 217
Grant Count 329
R01 Count 209
Funding $56,579,633.18
PubMed Score 1201.98
PubTator Score 434.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (48)

Expression

  Differential Expression (15)

Synonym

Accession O75197 Q96TD6 Q9UES7 Q9UP66 LRP-5
Symbols HBM
LR3
OPS
EVR1
EVR4
LRP7
OPPG
BMND1
LRP-5
OPTA1
VBCH2

Gene

Gene RIF (216)

PMID Text
26739212 LRP5 is a novel anti-inflammatory macrophage marker that positively regulates migration, phagocytosis, lipid uptake and metabolism.
26711269 Lrp5 controls glucose uptake and growth of MDA-MB-231 human breast cancer cells.
26681532 Data show that LDL receptor-related protein 5 (LRP5) gain-of-function mutations do not activate beta-catenin signaling in osteoblasts.
26666179 LRP5 is a signature of the anti-inflammatory defensive phenotype of macrophages.
26248735 No LRP5 variant was found to be associated with type 2 diabetes mellitus in Han Chinese, but haplotype TT was found to be associated with type 2 diabetes mellitus .
26244290 Among the patients with pathogenic mutations detected, FZD4 mutations accounted for the largest proportion of autosomal inheritance FEVR cases (13/18 patients, 72.2%), followed by LRP5 (4/18 patients, 22.2%) and TSPAN12 (1/18 patients, 5.6%).
26117992 mechanism of LRP protein action in the process of bone tissue metabolism and etiology of osteoporosis.
25959626 findings suggest that rescuing LRP5/6-mediated Wnt signaling improves neuronal cell survival and reduces tau phosphorylation, which support the hypothesis that Wnt signaling might be an attractive therapeutic strategy for managing AD
25945592 Molecular testing identified biallelic lipoprotein receptor-related protein 5 (LRP5) mutations (NM_002335.3:c. [889dupA]; [2827 + 1G > A]) confirming a diagnosis of osteoporosis-pseudoglioma (OPPG) syndrome.
25920554 we identified a total of four different LRP5 variants that were predicted to be pathogenic by in silico tools. One ADPKD patient has a positive family history for ADPKD and variant LRP5 segregated with the disease.
More...

AA Sequence

MEAAPPGPPWPLLLLLLLLLALCGCPAPAAASPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDF      1 - 70
QFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGT     71 - 140
SRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLY    141 - 210
WADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYS    211 - 280
PMDIQVLSQERQPFFHTRCEEDNGGCSHLCLLSPSEPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRT    281 - 350
DLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDG    351 - 420
IAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGENPKIECANLD    421 - 490
GQERRVLVNASLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYW    491 - 560
TDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPHATRCGCPIG    561 - 630
LELLSDMKTCIVPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTIS    631 - 700
RAFMNGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDP    701 - 770
TKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVV    771 - 840
IADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNN    841 - 910
GQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRNVK    911 - 980
AIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQGQNPDRQPHDLSIDIYSRTLFWTCEATNTINV    981 - 1050
HRLSGEAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVD   1051 - 1120
NTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPLGLTILGKHLYWIDRQQQMIERVEKTTGDKRTR   1121 - 1190
IQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCS   1191 - 1260
PDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEA   1261 - 1330
DCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVM   1331 - 1400
GGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGV   1401 - 1470
PLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPT   1471 - 1540
TPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSP   1541 - 1610
CTDSS                                                                    1611 - 1615
//

Text Mined References (232)

PMID Year Title
27228167 2016 Whole Exome Sequencing Analysis Identifies Mutations in LRP5 in Indian Families with Familial Exudative Vitreoretinopathy.
26739212 2016 LRP5: A novel anti-inflammatory macrophage marker that positively regulates migration and phagocytosis.
26711269 2015 Lrp5 Has a Wnt-Independent Role in Glucose Uptake and Growth for Mammary Epithelial Cells.
26681532 2016 Normal hematopoiesis and lack of ?-catenin activation in osteoblasts of patients and mice harboring Lrp5 gain-of-function mutations.
26666179 2016 LRP5 associates with specific subsets of macrophages: Molecular and functional effects.
26248735 2015 Association between Low-density Lipoprotein Receptor-related Protein 5 Polymorphisms and Type 2 Diabetes Mellitus in Han Chinese: a Case-control Study.
26244290 2015 Molecular Characterization of FZD4, LRP5, and TSPAN12 in Familial Exudative Vitreoretinopathy.
26117992 2015 [The role of Wnt/?-catenin pathway and LRP5 protein in metabolism of bone tissue and osteoporosis etiology].
25959626 2015 Wnt co-receptor LRP5/6 overexpression confers protection against hydrogen peroxide-induced neurotoxicity and reduces tau phosphorylation in SH-SY5Y cells.
25945592 2015 Congenital Bilateral Retinal Detachment in Two Siblings with Osteoporosis-Pseudoglioma Syndrome.
More...