Property Summary

NCBI Gene PubMed Count 16
PubMed Score 54.59
PubTator Score 5.85

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
ependymoma 2514 1.31633871393585E-9
psoriasis 6685 1.37096588902636E-5
ulcerative colitis 2087 2.71959633704257E-5
interstitial cystitis 2299 5.45648123772061E-5
urothelial carcinoma 318 0.0121426374563267


  Differential Expression (5)

Disease log2 FC p
urothelial carcinoma -1.500 0.012
psoriasis -1.100 0.000
ependymoma 1.600 0.000
ulcerative colitis -1.500 0.000
interstitial cystitis -1.700 0.000


Accession O75192 B4DV88 HsPEX11p
Symbols PMP28


  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

20826455 coordinates peroxisome membrane proliferation and maintenance
16567422 Cooperation with other transcription factors may be differentially involved in selective transactivation of the PEX11alpha gene by different peroxisome proliferator-activated receptor subtypes.
12417726 Mice lacking PEX11-alpha have normal peroxisome abundance.

AA Sequence

QLGIYKSNPGIIGLGGLVSSIAGMITVAYPQMKLKTR                                     211 - 247

Text Mined References (17)

PMID Year Title
21419861 2011 Peroxisomes: membrane events accompanying peroxisome proliferation.
20826455 2010 PEX11 family members are membrane elongation factors that coordinate peroxisome proliferation and maintenance.
19114594 2008 The peroxisomal membrane protein import receptor Pex3p is directly transported to peroxisomes by a novel Pex19p- and Pex16p-dependent pathway.
18782765 2008 Targeting of hFis1 to peroxisomes is mediated by Pex19p.
17220199 2007 The PEROXIN11 protein family controls peroxisome proliferation in Arabidopsis.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16567422 2006 Peroxisome proliferator-activated receptor subtypes differentially cooperate with other transcription factors in selective transactivation of the perilipin/PEX11 alpha gene pair.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.