Property Summary

NCBI Gene PubMed Count 16
PubMed Score 55.81
PubTator Score 5.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
active ulcerative colitis -1.014 1.3e-02
ependymoma 1.500 9.8e-10
interstitial cystitis -1.300 1.0e-02
psoriasis -1.100 1.4e-05
urothelial carcinoma -1.500 1.2e-02

Gene RIF (3)

AA Sequence

MDAFTRFTNQTQGRDRLFRATQYTCMLLRYLLEPKAGKEKVVMKLKKLESSVSTGRKWFRLGNVVHAIQA      1 - 70
TEQSIHATDLVPRLCLTLANLNRVIYFICDTILWVRSVGLTSGINKEKWRTRAAHHYYYSLLLSLVRDLY     71 - 140
EISLQMKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLLLDTVKNLCDILNPLD    141 - 210
QLGIYKSNPGIIGLGGLVSSIAGMITVAYPQMKLKTR                                     211 - 247
//

Text Mined References (17)

PMID Year Title