Property Summary

NCBI Gene PubMed Count 12
PubMed Score 93.10
PubTator Score 10.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7950 1.3e-06
psoriasis 6694 4.6e-04
intraductal papillary-mucinous adenoma (IPMA) 2955 6.6e-04
lung cancer 4740 6.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Heart conduction disease 83 0.0 1.1
Disease Target Count Z-score Confidence
Retinitis pigmentosa 4 38 3.75 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.100 6.6e-04
lung cancer 1.500 6.4e-03
osteosarcoma -1.596 1.3e-06
psoriasis -1.200 4.6e-04

Gene RIF (4)

AA Sequence

MAEHAPRRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQ      1 - 70
ALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDS     71 - 140
STTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSP    141 - 210
IDYSDGSGMNLLQIQDKVWSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGD    211 - 280
NPASLAGMRLEEGDIAVSLGTSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNES    281 - 350
VSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKR    351 - 420
IHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFS    421 - 490
EVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQTRGPPE                            491 - 536
//

Text Mined References (16)

PMID Year Title