Property Summary

NCBI Gene PubMed Count 64
Grant Count 52
R01 Count 33
Funding $16,682,090.56
PubMed Score 95.88
PubTator Score 53.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
pancreatic cancer 1.100 0.001
esophageal adenocarcinoma -1.300 0.022
glioblastoma multiforme 1.100 0.000
osteosarcoma -2.096 0.000
astrocytoma 1.300 0.040
tuberculosis and treatment for 6 months -1.900 0.000
pancreatic carcinoma 1.100 0.001
ovarian cancer 1.700 0.000

Gene RIF (38)

PMID Text
26702057 DnaJB6-protected yeast cells from polyglutamine toxicity and cured yeast of both [URE3] prions and weak variants of [PSI(+)] prions but not strong [PSI(+)] prions
26371419 Functional study using zebrafish embryos demonstrated that p.Phe91Leu elicits more severe muscle defects than the reported p.Phe93Leu and p.Pro96Arg mutations
26362252 LGMD1D mutations in DNAJB6 disrupt its sarcoplasmic function suggesting a role for DNAJB6b in Z-disc organization and stress granule kinetics.
26338452 DNAJB6 mutations p.F91I and p.F91L show a significant reduction of the anti-aggregation function compared to the wild-type and p.F93L mutation
26302489 DNAJB6a reduces AKT signaling, and DNAJB6 expression in cancer cells reduces their proliferation and growth of xenograft esophageal squamous cell tumors in mice.
26205529 This study showed that Complete loss of the DNAJB6 G/F domain and novel missense mutations cause distal-onset DNAJB6 myopathy.
26137520 The nuclear localization of HIV-1 Vpr is facilitated by DNAJB6 (MRJ-L)
25306414 Geneticanalysis indicated a heterozygous missense mutation of c.279C>G
25217638 DNAJB6 interacts with growing amyloid-beta 42 (Abeta42) aggregates, which leads to sub-stoichiometric inhibition of amyloid formation
25175595 Findings suggest a novel function of HSP70/MRJ/uPAR complex in cell adhesion, invasion and migration, and may provide more understanding in the mechanisms of uPAR-mediated cancer metastasis.
More...

AA Sequence

MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGK      1 - 70
EGLNGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFEDFFGNRRGPRGSRSRGTGSF     71 - 140
FSAFSGFPSFGSGFSSFDTGFTSFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKMVNGRKITTKRIVE    141 - 210
NGQERVEVEEDGQLKSLTINGVADDDALAEERMRRGQNALPAQPAGLRPPKPPRPASLLRHAPHCLSEEE    211 - 280
GEQDRPRAPGPWDPLASAAGLKEGGKRKKQKQREESKKKKSTKGNH                            281 - 326
//

Text Mined References (69)

PMID Year Title
26702057 2016 Human J-protein DnaJB6b Cures a Subset of Saccharomyces cerevisiae Prions and Selectively Blocks Assembly of Structurally Related Amyloids.
26371419 2015 A novel mutation in DNAJB6, p.(Phe91Leu), in childhood-onset LGMD1D with a severe phenotype.
26362252 2015 Myofibrillar disruption and RNA-binding protein aggregation in a mouse model of limb-girdle muscular dystrophy 1D.
26338452 2015 Novel mutations in DNAJB6 gene cause a very severe early-onset limb-girdle muscular dystrophy 1D disease.
26302489 2015 Nuclear Localization of DNAJB6 Is Associated With Survival of Patients With Esophageal Cancer and Reduces AKT Signaling and Proliferation of Cancer Cells.
26205529 2015 Complete loss of the DNAJB6 G/F domain and novel missense mutations cause distal-onset DNAJB6 myopathy.
25306414 2014 Pathology of frontotemporal dementia with limb girdle muscular dystrophy caused by a DNAJB6 mutation.
25217638 2014 Interaction of the molecular chaperone DNAJB6 with growing amyloid-beta 42 (A?42) aggregates leads to sub-stoichiometric inhibition of amyloid formation.
25175595 2014 Heat shock proteins HSP70 and MRJ cooperatively regulate cell adhesion and migration through urokinase receptor.
25044025 2015 Overexpression of DNAJB6 promotes colorectal cancer cell invasion through an IQGAP1/ERK-dependent signaling pathway.
More...