Property Summary

NCBI Gene PubMed Count 14
PubMed Score 18.18
PubTator Score 15.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Chronic Obstructive Airway Disease 47
Disease Target Count P-value
osteosarcoma 7933 3.92755567710786E-7
atypical teratoid / rhabdoid tumor 4369 1.00552252475374E-5
medulloblastoma, large-cell 6234 3.78032392318774E-5
interstitial cystitis 2299 7.69222358662462E-5
psoriasis 6685 9.3820151147335E-5
pancreatic cancer 2300 3.945966113263E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.24731968412531E-4
fibroadenoma 557 6.6727801388727E-4
invasive ductal carcinoma 2950 0.00202556697578362
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00271571801227491
lung cancer 4473 0.00369233095726997
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00597254213050566
ductal carcinoma in situ 1745 0.00968246988672577
chronic rhinosinusitis 512 0.0160870750489377
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 0.0 1.0

Expression

Synonym

Accession O75185 B4DU76 E7ES94 Q5HYC3 Q5S053 Q68CQ2 ATPase 2C2
Symbols SPCA2

Gene

PANTHER Protein Class (2)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (8)

PMID Text
25448322 Supporting a more general neurocognition role of ATP2C2 is the previous association of ATP2C2 with attention deficit hyperactivity disorder, a condition commonly comorbid with dyslexia and language impairment.
20887894 Findings reveal a signaling pathway in which the Orai1-SPCA2 complex elicits constitutive store-independent Ca(2+) signaling that promotes tumorigenesis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19646677 ATP2C2 modulates phonological short-term memory in language impairment.
18676988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16332677 analysis of SPCA1 and SPCA2 isoenzymes by steady-state and transient kinetic analyses
15831496 hSPCA2 has the ability to transport Ca(2+) and Mn(2+); both its transport and Ca(2+)- and Mn(2+)-dependent phosphoprotein intermediate formation functions are insensitive to thapsigargin inhibition
15677451 SPCA2 may have a more specialized role in mammalian cells, possibly in cellular detoxification of Mn2+ ions.

AA Sequence

MVEGRVSEFLKKLGFSGGGRQYQALEKDEEEALIDEQSELKAIEKEKKVTALPPKEACKCQKEDLARAFC      1 - 70
VDLHTGLSEFSVTQRRLAHGWNEFVADNSEPVWKKYLDQFKNPLILLLLGSALVSVLTKEYEDAVSIATA     71 - 140
VLVVVTVAFIQEYRSEKSLEELTKMVPPECNCLREGKLQHLLARELVPGDVVSLSIGDRIPADIRLTEVT    141 - 210
DLLVDESSFTGEAEPCSKTDSPLTGGGDLTTLSNIVFMGTLVQYGRGQGVVIGTGESSQFGEVFKMMQAE    211 - 280
ETPKTPLQKSMDRLGKQLTLFSFGIIGLIMLIGWSQGKQLLSMFTIGVSLAVAAIPEGLPIVVMVTLVLG    281 - 350
VLRMAKKRVIVKKLPIVETLGCCSVLCSDKTGTLTANEMTVTQLVTSDGLRAEVSGVGYDGQGTVCLLPS    351 - 420
KEVIKEFSNVSVGKLVEAGCVANNAVIRKNAVMGQPTEGALMALAMKMDLSDIKNSYIRKKEIPFSSEQK    421 - 490
WMAVKCSLKTEDQEDIYFMKGALEEVIRYCTMYNNGGIPLPLTPQQRSFCLQEEKRMGSLGLRVLALASG    491 - 560
PELGRLTFLGLVGIIDPPRVGVKEAVQVLSESGVSVKMITGDALETALAIGRNIGLCNGKLQAMSGEEVD    561 - 630
SVEKGELADRVGKVSVFFRTSPKHKLKIIKALQESGAIVAMTGDGVNDAVALKSADIGIAMGQTGTDVSK    631 - 700
EAANMILVDDDFSAIMNAVEEGKGIFYNIKNFVRFQLSTSISALSLITLSTVFNLPSPLNAMQILWINII    701 - 770
MDGPPAQSLGVEPVDKDAFRQPPRSVRDTILSRALILKILMSAAIIISGTLFIFWKEMPEDRASTPRTTT    771 - 840
MTFTCFVFFDLFNALTCRSQTKLIFEIGFLRNHMFLYSVLGSILGQLAVIYIPPLQRVFQTENLGALDLL    841 - 910
FLTGLASSVFILSELLKLCEKYCCSPKRVQMHPEDV                                      911 - 946
//

Text Mined References (17)

PMID Year Title
25448322 2015 Language impairment and dyslexia genes influence language skills in children with autism spectrum disorders.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
20887894 2010 Store-independent activation of Orai1 by SPCA2 in mammary tumors.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19646677 2009 CMIP and ATP2C2 modulate phonological short-term memory in language impairment.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
18676988 2008 A high-density association screen of 155 ion transport genes for involvement with common migraine.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16332677 2006 Dissection of the functional differences between human secretory pathway Ca2+/Mn2+-ATPase (SPCA) 1 and 2 isoenzymes by steady-state and transient kinetic analyses.
More...