Property Summary

NCBI Gene PubMed Count 14
Grant Count 8
R01 Count 8
Funding $625,505
PubMed Score 18.18
PubTator Score 15.76

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
25448322 Supporting a more general neurocognition role of ATP2C2 is the previous association of ATP2C2 with attention deficit hyperactivity disorder, a condition commonly comorbid with dyslexia and language impairment.
20887894 Findings reveal a signaling pathway in which the Orai1-SPCA2 complex elicits constitutive store-independent Ca(2+) signaling that promotes tumorigenesis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19646677 ATP2C2 modulates phonological short-term memory in language impairment.
18676988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16332677 analysis of SPCA1 and SPCA2 isoenzymes by steady-state and transient kinetic analyses
15831496 hSPCA2 has the ability to transport Ca(2+) and Mn(2+); both its transport and Ca(2+)- and Mn(2+)-dependent phosphoprotein intermediate formation functions are insensitive to thapsigargin inhibition
15677451 SPCA2 may have a more specialized role in mammalian cells, possibly in cellular detoxification of Mn2+ ions.

AA Sequence

MVEGRVSEFLKKLGFSGGGRQYQALEKDEEEALIDEQSELKAIEKEKKVTALPPKEACKCQKEDLARAFC      1 - 70
VDLHTGLSEFSVTQRRLAHGWNEFVADNSEPVWKKYLDQFKNPLILLLLGSALVSVLTKEYEDAVSIATA     71 - 140
VLVVVTVAFIQEYRSEKSLEELTKMVPPECNCLREGKLQHLLARELVPGDVVSLSIGDRIPADIRLTEVT    141 - 210
DLLVDESSFTGEAEPCSKTDSPLTGGGDLTTLSNIVFMGTLVQYGRGQGVVIGTGESSQFGEVFKMMQAE    211 - 280
ETPKTPLQKSMDRLGKQLTLFSFGIIGLIMLIGWSQGKQLLSMFTIGVSLAVAAIPEGLPIVVMVTLVLG    281 - 350
VLRMAKKRVIVKKLPIVETLGCCSVLCSDKTGTLTANEMTVTQLVTSDGLRAEVSGVGYDGQGTVCLLPS    351 - 420
KEVIKEFSNVSVGKLVEAGCVANNAVIRKNAVMGQPTEGALMALAMKMDLSDIKNSYIRKKEIPFSSEQK    421 - 490
WMAVKCSLKTEDQEDIYFMKGALEEVIRYCTMYNNGGIPLPLTPQQRSFCLQEEKRMGSLGLRVLALASG    491 - 560
PELGRLTFLGLVGIIDPPRVGVKEAVQVLSESGVSVKMITGDALETALAIGRNIGLCNGKLQAMSGEEVD    561 - 630
SVEKGELADRVGKVSVFFRTSPKHKLKIIKALQESGAIVAMTGDGVNDAVALKSADIGIAMGQTGTDVSK    631 - 700
EAANMILVDDDFSAIMNAVEEGKGIFYNIKNFVRFQLSTSISALSLITLSTVFNLPSPLNAMQILWINII    701 - 770
MDGPPAQSLGVEPVDKDAFRQPPRSVRDTILSRALILKILMSAAIIISGTLFIFWKEMPEDRASTPRTTT    771 - 840
MTFTCFVFFDLFNALTCRSQTKLIFEIGFLRNHMFLYSVLGSILGQLAVIYIPPLQRVFQTENLGALDLL    841 - 910
FLTGLASSVFILSELLKLCEKYCCSPKRVQMHPEDV                                      911 - 946
//

Text Mined References (17)

PMID Year Title
25448322 2015 Language impairment and dyslexia genes influence language skills in children with autism spectrum disorders.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
20887894 2010 Store-independent activation of Orai1 by SPCA2 in mammary tumors.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19646677 2009 CMIP and ATP2C2 modulate phonological short-term memory in language impairment.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
18676988 2008 A high-density association screen of 155 ion transport genes for involvement with common migraine.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16332677 2006 Dissection of the functional differences between human secretory pathway Ca2+/Mn2+-ATPase (SPCA) 1 and 2 isoenzymes by steady-state and transient kinetic analyses.
More...