Property Summary

NCBI Gene PubMed Count 34
Grant Count 23
R01 Count 17
Funding $2,053,892.1
PubMed Score 18.01
PubTator Score 17.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 2.069 0.000
inflammatory breast cancer 1.200 0.011
Pick disease -1.200 0.001

Gene RIF (14)

PMID Text
26181367 these results suggest that stress-induced Sin3B activation is p53-dependent and is essential for p53-mediated repression of its selective target genes.
25869359 The study suggests that the difference in the conformation of native state structure or structural flexibility of the paired amphi pathic helices (PAH) domains of Sin3B might be responsible for interacting with specific binding partners.
24951594 A conserved Myc region (amino acids 186-203) is required for the interaction with Sin3 proteins. Histone deacetylase 1 is recruited to Myc-Sin3b complexes, and its deacetylase activity is required for the effects of Sin3b on Myc.
24709079 this study highlights an essential role for Sin3B in IFN-c induced COL1A2 repression in smooth muscle cells.
24691445 Senescence-associated SIN3B promotes inflammation and pancreatic cancer progression
22028823 the essential role of Sin3B as an important associate of p53 in mediating the cellular responses to stress and in the transcriptional repression of genes
21041482 identification of a mammalian complex containing the corepressor Sin3B, the histone deacetylase HDAC1, Mrg15, and the PHD finger-containing Pf1
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20547842 disruption of the function of a specific Sin3A/B domain leads to epigenetic reprogramming and derepression of specific subsets of genes in breast cancer cells
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAHAGGGSGGSGAGGPAGRGLSGARWGRSGSAGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLEIMK      1 - 70
EFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLTSQENSHNHGDGAEDF     71 - 140
KQQVPYKEDKPQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLNTRGRPFRGMSE    141 - 210
EEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTGNGPCEMHSVQKNEHDKTPEHSRKRSRPSLLRPVSA    211 - 280
PAKKKMKLRGTKDLSIAAVGKYGTLQEFSFFDKVRRVLKSQEVYENFLRCIALFNQELVSGSELLQLVSP    281 - 350
FLGKFPELFAQFKSFLGVKELSFAPPMSDRSGDGISREIDYASCKRIGSSYRALPKTYQQPKCSGRTAIC    351 - 420
KELDHWTLLQGSWTDDYCMSKFKNTCWIPGYSAGVLNDTWVSFPSWSEDSTFVSSKKTPYEEQLHRCEDE    421 - 490
RFELDVVLETNLATIRVLESVQKKLSRMAPEDQEKFRLDDSLGGTSEVIQRRAIYRIYGDKAPEIIESLK    491 - 560
KNPVTAVPVVLKRLKAKEEEWREAQQGFNKIWREQYEKAYLKSLDHQAVNFKQNDTKALRSKSLLNEIES    561 - 630
VYDEHQEQHSEGRSAPSSEPHLIFVYEDRQILEDAAALISYYVKRQPAIQKEDQGTIHQLLHQFVPSLFF    631 - 700
SQQLDLGASEESADEDRDSPQGQTTDPSERKKPAPGPHSSPPEEKGAFGDAPATEQPPLPPPAPHKPLDD    701 - 770
VYSLFFANNNWYFFLRLHQTLCSRLLKIYRQAQKQLLEYRTEKEREKLLCEGRREKGSDPAMELRLKQPS    771 - 840
EVELEEYYPAFLDMVRSLLEGSIDPTQYEDTLREMFTIHAYVGFTMDKLVQNIARQLHHLVSDDVCLKVV    841 - 910
ELYLNEKKRGAAGGNLSSRCVRAARETSYQWKAERCMADENCFKVMFLQRKGQVIMTIELLDTEEAQTED    911 - 980
PVEVQHLARYVEQYVGTEGASSSPTEGFLLKPVFLQRNLKKFRRRWQSEQARALRGEARSSWKRLVGVES    981 - 1050
ACDVDCRFKLSTHKMVFIVNSEDYMYRRGTLCRAKQVQPLVLLRHHQHFEEWHSRWLEDNVTVEAASLVQ   1051 - 1120
DWLMGEEDEDMVPCKTLCETVHVHGLPVTRYRVQYSRRPASP                               1121 - 1162
//

Text Mined References (36)

PMID Year Title
26181367 2015 Stress-mediated Sin3B activation leads to negative regulation of subset of p53 target genes.
25869359 2015 pH might play a role in regulating the function of paired amphipathic helices domains of human Sin3B by altering structure and thermodynamic stability.
24951594 2014 Sin3b interacts with Myc and decreases Myc levels.
24709079 2014 Sin3B mediates collagen type I gene repression by interferon gamma in vascular smooth muscle cells.
24691445 2014 Senescence-associated SIN3B promotes inflammation and pancreatic cancer progression.
23460338 2013 C6orf89 encodes three distinct HDAC enhancers that function in the nucleolus, the golgi and the midbody.
22028823 2011 Tumor suppressor protein p53 recruits human Sin3B/HDAC1 complex for down-regulation of its target promoters in response to genotoxic stress.
21041482 2011 A novel mammalian complex containing Sin3B mitigates histone acetylation and RNA polymerase II progression within transcribed loci.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20547842 2010 Interference with Sin3 function induces epigenetic reprogramming and differentiation in breast cancer cells.
More...