Property Summary

NCBI Gene PubMed Count 35
PubMed Score 21.43
PubTator Score 17.86

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 8.1e-08
Pick disease 1894 1.5e-03
inflammatory breast cancer 286 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6


  Differential Expression (3)

Disease log2 FC p
inflammatory breast cancer 1.200 1.1e-02
osteosarcoma 2.069 8.1e-08
Pick disease -1.200 1.5e-03

Gene RIF (15)

AA Sequence

DWLMGEEDEDMVPCKTLCETVHVHGLPVTRYRVQYSRRPASP                               1121 - 1162

Text Mined References (37)

PMID Year Title