Property Summary

NCBI Gene PubMed Count 26
Grant Count 26
R01 Count 20
Funding $3,884,473.3
PubMed Score 523.79
PubTator Score 13.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
ependymoma 1.100 0.009
osteosarcoma -3.925 0.000
group 3 medulloblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma -1.200 0.000
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor 1.200 0.000
lung cancer 1.600 0.000
pediatric high grade glioma -1.100 0.000

Gene RIF (9)

PMID Text
24121232 The CNOT2-CNOT3 heterodimer is stabilized and tightly anchored to the surface of CNOT1 through an unexpected intertwined arrangement of peptide regions lacking defined secondary structure.
24116917 A mutation in PRPF31 is hypostatic to a trait acting on CNOT3, with the RP11 phenotype only being observed when there is homozygous (recessive) inheritance of the higher expressivity CNOT3 ("symptomatic" or risk) allele.
23263491 CNOT3 is a tumor suppressor mutated in 7 of 89 (7.9%) adult T-cell acute lymphoblastic leukemias, and its knockdown causes tumors in a sensitized Drosophila melanogaster model.
23144630 In asymptomatic carriers CNOT3 is expressed at low levels, allowing higher amounts of wild-type PRPF31 transcripts to be produced and preventing manifestation of retinal degeneration.
22367759 Cnot1, Cnot2, and Cnot3 represent a novel component of the core self-renewal and pluripotency circuitry conserved in mouse and human ESCs.
22342980 CNOT3 depletion stabilizes the MAD1 mRNA, and MAD1 knockdown attenuates the CNOT3 depletion-induced increase of the mitotic index.
22294640 A high density SNP genotyping approach within the 19q13 chromosome region identifies an association of a CNOT3 polymorphism with ankylosing spondylitis.
20970119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12207886 TBP-interacting protein 120B binds to NOT3

AA Sequence

MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNE      1 - 70
IKDKRQLIDNRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKEEVGQWLTNTIDTLNMQVD     71 - 140
QFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRMLDNDSILVDAIRKIKDDVEYY    141 - 210
VDSSQDPDFEENEFLYDDLDLEDIPQALVATSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTE    211 - 280
NSEDDKKRGRSTDSEVSQSPAKNGSKPVHSNQHPQSPAVPPTYPSGPPPAASALSTTPGNNGVPAPAAPP    281 - 350
SALGPKASPAPSHNSGTPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGA    351 - 420
GKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSAAAPTGAGGVAPGSGNN    421 - 490
SGGPSLLVPLPVNPPSSPTPSFSDAKAAGALLNGPPQFSTAPEIKAPEPLSSLKSMAERAAISSGIEDPV    491 - 560
PTLHLTERDIILSSTSAPPASAQPPLQLSEVNIPLSLGVCPLGPVPLTKEQLYQQAMEEAAWHHMPHPSD    561 - 630
SERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHT    631 - 700
KYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDLQ                     701 - 753
//

Text Mined References (34)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24736845 2014 Structural basis for the Nanos-mediated recruitment of the CCR4-NOT complex and translational repression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24121232 2013 Structure and assembly of the NOT module of the human CCR4-NOT complex.
24116917 2014 Dominant PRPF31 mutations are hypostatic to a recessive CNOT3 polymorphism in retinitis pigmentosa: a novel phenomenon of "linked trans-acting epistasis".
23263491 2013 Exome sequencing identifies mutation in CNOT3 and ribosomal genes RPL5 and RPL10 in T-cell acute lymphoblastic leukemia.
23144630 2012 CNOT3 is a modifier of PRPF31 mutations in retinitis pigmentosa with incomplete penetrance.
22367759 2012 Cnot1, Cnot2, and Cnot3 maintain mouse and human ESC identity and inhibit extraembryonic differentiation.
22342980 2012 Involvement of CNOT3 in mitotic progression through inhibition of MAD1 expression.
22294640 2012 A high density SNP genotyping approach within the 19q13 chromosome region identifies an association of a CNOT3 polymorphism with ankylosing spondylitis.
More...