Property Summary

NCBI Gene PubMed Count 94
Grant Count 44
R01 Count 34
Funding $4,125,847.67
PubMed Score 46.65
PubTator Score 149.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.419 0.000
non diabetic and post-ischemic heart fai... -1.200 0.005
inflammatory breast cancer 1.700 0.004
psoriasis 2.100 0.000

Gene RIF (75)

PMID Text
26916548 progesterone acts via the progesterone receptor to modulate ADAMTS 1 and 4 levels in ovarian cancer cell lines.
26612259 These data demonstrate that the antibody is specific to ADAMTS4 and ADAMTS5 and inhibits their aggrecanase activity at molecular and cellular levels.
25709087 CCN1 suppresses ADAMTS-4 activity and that CCN1 overexpression is directly correlated with chondrocyte cloning in osteoarthritis cartilage. The TGFbeta/CCN1 axis plays a role in chondrocyte cluster formation through inhibition of ADAMTS-4.
25707877 A positive feedback loop involving sSema4D/IL-6 and TNFalpha/ADAMTS-4 may contribute to the pathogenesis of rheumatoid arthritis.
25592103 ADAMTS4 may be responsible for the pathogenesis of atherosclerosis. ADAMTS4 serum levels were also higher in diabetic cases. There is an association between ADAMTS4 and TGFb1 serum levels in the progression of atherosclerosis in coronary artery disease.
25501175 ADAMTS-4 is a potential biomarker and an early diagnostic indicator of knee osteoarthritis.
25477257 Evaluate ADAMTS-4 and ADAMTS-5 immunohistochemical expression in human TMJ discs from patients affected by internal derangement.
25225099 ADAMTS4 is largely associated with synapses, and is the main brevican-processing protease.
24786121 The restricted expression of ADAMTS-4 and ADAMTS-5 and their increased expression in gestational trophoblastic diseases suggest that these 2 ADAMTS subtypes are associated with human placentation and the development of gestational trophoblastic diseases.
24732836 We conclude that the upregulation of TNF-alpha and ADAMTS-5, but not ADAMTS-4, may play an important role in degenerative cartilage endplate-induced low back pain.
More...

AA Sequence

MSQTGSHPGRGLAGRWLWGAQPCLLLPIVPLSWLVWLLLLLLASLLPSARLASPLPREEEIVFPEKLNGS      1 - 70
VLPGSGAPARLLCRLQAFGETLLLELEQDSGVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVA     71 - 140
SLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCNVKAPLGSPSPRPRRA    141 - 210
KRFASLSRFVETLVVADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQ    211 - 280
VGPSAAQTLRSFCAWQRGLNTPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVED    281 - 350
DGLQSAFTAAHELGHVFNMLHDNSKPCISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGY    351 - 420
GHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHAMCQTKHSPWA    421 - 490
DGTPCGPAQACMGGRCLHMDQLQDFNIPQAGGWGPWGPWGDCSRTCGGGVQFSSRDCTRPVPRNGGKYCE    491 - 560
GRRTRFRSCNTEDCPTGSALTFREEQCAAYNHRTDLFKSFPGPMDWVPRYTGVAPQDQCKLTCQAQALGY    561 - 630
YYVLEPRVVDGTPCSPDSSSVCVQGRCIHAGCDRIIGSKKKFDKCMVCGGDGSGCSKQSGSFRKFRYGYN    631 - 700
NVVTIPAGATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASET    701 - 770
LSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFVPRPTPSTPRPTPQDWLHRRAQILEILRRRPWAGRK       771 - 837
//

Text Mined References (94)

PMID Year Title
26916548 2016 Progesterone acts via the progesterone receptor to induce adamts proteases in ovarian cancer cells.
26612259 2016 Development of human neutralizing antibody to ADAMTS4 (aggrecanase-1) and ADAMTS5 (aggrecanase-2).
25709087 2015 CCN1 (Cyr61) Is Overexpressed in Human Osteoarthritic Cartilage and Inhibits ADAMTS-4 (Aggrecanase 1) Activity.
25707877 2015 Semaphorin 4D Contributes to Rheumatoid Arthritis by Inducing Inflammatory Cytokine Production: Pathogenic and Therapeutic Implications.
25606593 2014 Current and emerging therapeutic strategies for preventing inflammation and aggrecanase-mediated cartilage destruction in arthritis.
25592103 2015 A novel association between TGFb1 and ADAMTS4 in coronary artery disease: A new potential mechanism in the progression of atherosclerosis and diabetes.
25501175 2014 Increased serum ADAMTS-4 in knee osteoarthritis: a potential indicator for the diagnosis of osteoarthritis in early stages.
25477257 2015 ADAMTS-4 and ADAMTS-5 expression in human temporomandibular joint discs with internal derangement, correlates with degeneration.
25225099 2014 Hyaluronan-based extracellular matrix under conditions of homeostatic plasticity.
24786121 2014 Differential expression patterns of a disintegrin and metalloproteinase with thrombospondin motifs (ADAMTS) -1, -4, -5, and -14 in human placenta and gestational trophoblastic diseases.
More...