Property Summary

NCBI Gene PubMed Count 14
PubMed Score 50.34
PubTator Score 34.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.200 1.9e-04
atypical teratoid / rhabdoid tumor -1.400 3.0e-05
glioblastoma -1.500 2.9e-06
medulloblastoma, large-cell -1.500 3.4e-04
osteosarcoma -3.972 2.7e-10
posterior fossa group A ependymoma -1.100 9.7e-07
psoriasis -3.300 6.4e-06

Synonym

Accession O75170 A6PVG3 B7Z7T3 Q5U5P3 Q7Z2L2 Q7Z5G5 Q7Z731 Q9UGB9
Symbols PP6R2
SAPS2
SAP190
KIAA0685

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 MGI Phenotype (1)

 GWAS Trait (1)

AA Sequence

MFWKFDLNTTSHVDKLLDKEHVTLQELMDEDDILQECKAQNQKLLDFLCRQQCMEELVSLITQDPPLDME      1 - 70
EKVRFKYPNTACELLTCDVPQISDRLGGDESLLSLLYDFLDHEPPLNPLLASFFSKTIGNLIARKTEQVI     71 - 140
TFLKKKDKFISLVLKHIGTSALMDLLLRLVSCVEPAGLRQDVLHWLNEEKVIQRLVELIHPSQDEDRQSN    141 - 210
ASQTLCDIVRLGRDQGSQLQEALEPDPLLTALESQDCVEQLLKNMFDGDRTESCLVSGTQVLLTLLETRR    211 - 280
VGTEGLVDSFSQGLERSYAVSSSVLHGIEPRLKDFHQLLLNPPKKKAILTTIGVLEEPLGNARLHGARLM    281 - 350
AALLHTNTPSINQELCRLNTMDLLLDLFFKYTWNNFLHFQVELCIAAILSHAAREERTEASGSESRVEPP    351 - 420
HENGNRSLETPQPAASLPDNTMVTHLFQKCCLVQRILEAWEANDHTQAAGGMRRGNMGHLTRIANAVVQN    421 - 490
LERGPVQTHISEVIRGLPADCRGRWESFVEETLTETNRRNTVDLVSTHHLHSSSEDEDIEGAFPNELSLQ    491 - 560
QAFSDYQIQQMTANFVDQFGFNDEEFADQDDNINAPFDRIAEINFNIDADEDSPSAALFEACCSDRIQPF    561 - 630
DDDEDEDIWEDSDTRCAARVMARPRFGAPHASESCSKNGPERGGQDGKASLEAHRDAPGAGAPPAPGKKE    631 - 700
APPVEGDSEGAMWTAVFDEPANSTPTAPGVVRDVGSSVWAAGTSAPEEKGWAKFTDFQPFCCSESGPRCS    701 - 770
SPVDTECSHAEGSRSQGPEKASQASYFAVSPASPCAWNVCVTRKAPLLASDSSSSGGSHSEDGDQKAASA    771 - 840
MDAVSRGPGREAPPLPTVARTEEAVGRVGCADSRLLSPACPAPKEVTAAPAVAVPPEATVAITTALSKAG    841 - 910
PAIPTPAVSSALAVAVPLGPIMAVTAAPAMVATLGTVTKDGKTDAPPEGAALNGPV                  911 - 966
//

Text Mined References (22)

PMID Year Title