Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.00
PubTator Score 4.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 9.1571620912517E-33
non-small cell lung cancer 2798 2.47051779899056E-24
lung adenocarcinoma 2714 2.83388343949723E-16
ovarian cancer 8492 1.87436651427773E-11
juvenile dermatomyositis 1189 1.29329195169089E-9
glioblastoma 5572 2.57567486212673E-9
pituitary cancer 1972 3.11229063845322E-9
Pick disease 1893 1.08492148784492E-6
lung cancer 4473 1.49595546565227E-5
pilocytic astrocytoma 3086 1.60405182063859E-5
malignant mesothelioma 3163 3.53071503086196E-5
Duchenne muscular dystrophy 602 2.29300314373164E-4
adult high grade glioma 2148 4.03109108862011E-4
Amyotrophic Lateral Sclerosis 432 6.16320032352925E-4
atypical teratoid / rhabdoid tumor 4369 7.52199497222353E-4
sonic hedgehog group medulloblastoma 1482 0.0015748924175053
posterior fossa group B ependymoma 1530 0.00321137202244742
Rheumatoid Arthritis 1171 0.00343757350379027
osteosarcoma 7933 0.0046325620827883
acute quadriplegic myopathy 1157 0.00575885506147748
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00969487523868521
invasive ductal carcinoma 2950 0.0124144248390835
primary pancreatic ductal adenocarcinoma 1271 0.0147730523153665
permanent atrial fibrillation 44 0.017121101746333
non primary Sjogren syndrome sicca 840 0.0225764611179573
adrenocortical carcinoma 1427 0.0260441546984129
spina bifida 1064 0.0341669696973994
chronic kidney disease 90 0.0381320801475154
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0395338501499042
hereditary spastic paraplegia 313 0.0494778698920058
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0
Impotence 45 0.0 1.0

Expression

Synonym

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

 GO Process (1)

Gene RIF (8)

PMID Text
25399010 The frequencies of genotype and allele in CHRNA3 (rs8040868) and PHACTR2 (rs9390123) were not significantly different between the NSCLC cases and controls, or between either of the subgroups.
23333304 HIV-1 Vif downregulates the expression of phosphatase and actin regulator 2 (PHACTR2) in Vif-expression T cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20546594 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19429005 identified an association between Phactr2 SNP rs11155313 and Parkinson's disease in US, Canadian and Irish patient populations, but not in a Norwegian population
19429005 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDNAVDGLDKASIANSDGPTAGSQTPPFKRKGKLSTIGKIFKPWKWRKKKTSDKFRETSAVLERKISTRQ      1 - 70
SREELIRRGVLKELPDQDGDVTVNFENSNGHMIPIGEESTREENVVKSEEGNGSVSEKTPPLEEQAEDKK     71 - 140
ENTENHSETPAAPALPPSAPPKPRPKPKPKKSPVPPKGATAGASHKGDEVPPIKKNTKAPGKQAPVPPPK    141 - 210
PASRNTTREAAGSSHSKKTTGSKASASPSTSSTSSRPKASKETVSSKAGTVGTTKGKRKTDKQPITSHLS    211 - 280
SDTTTSGTSDLKGEPAETRVESFKLEQTVPGAEEQNTGKFKSMVPPPPVAPAPSPLAPPLPLEDQCITAS    281 - 350
DTPVVLVSVGADLPVSALDPSQLLWAEEPTNRTTLYSGTGLSVNRENAKCFTTKEELGKTVPQLLTPGLM    351 - 420
GESSESFSASEDEGHREYQANDSDSDGPILYTDDEDEDEDEDGSGESALASKIRRRDTLAIKLGNRPSKK    421 - 490
ELEDKNILQRTSEEERQEIRQQIGTKLVRRLSQRPTTEELEQRNILKQKNEEEEQEAKMELKRRLSRKLS    491 - 560
LRPTVAELQARRILRFNEYVEVTDSPDYDRRADKPWARLTPADKAAIRKELNEFKSTEMEVHEESRQFTR    561 - 630
FHRP                                                                      631 - 634
//

Text Mined References (25)

PMID Year Title
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25399010 2014 Association between polymorphisms in CHRNA3 and PHACTR2 gene and environment and NSCLC risk in Chinese population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23108145 2013 Genome-wide association study reveals novel genetic determinants of DNA repair capacity in lung cancer.
22704111 2012 Pilot genome-wide association search identifies potential loci for risk of erectile dysfunction in type 1 diabetes using the DCCT/EDIC study cohort.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20546594 2010 An application of Random Forests to a genome-wide association dataset: methodological considerations & new findings.
More...