Property Summary

NCBI Gene PubMed Count 58
Grant Count 53
R01 Count 34
Funding $5,967,371.56
PubMed Score 1030.21
PubTator Score 89.36

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O75164 Q5VVB1
Symbols JMJD2
JHDM3A
JMJD2A
TDRD14A

Gene

PDB

2QQS   5FWE   2GF7   2GFA   2GP3   2GP5   2OQ6   2OQ7   2OS2   2OT7   2OX0   2P5B   2PXJ   2Q8C   2Q8D   2Q8E   2QQR   2VD7   2WWJ   2YBK   2YBP   2YBS   3NJY   3PDQ   3RVH   3U4S   4AI9   4BIS   4GD4   4URA   4V2V   4V2W   5A7N   5A7O   5A7P   5A7Q   5A7S   5A7W   5A80   5ANQ   5D6W   5D6X   5D6Y   5F2S   5F2W   5F32   5F37   5F39   5F3C   5F3E   5F3G   5F3I   5F5I   5FPV   5FY8   5FYC   5FYH   5FYI  

Gene RIF (40)

PMID Text
26868148 Results indicate that SCF(Fbxo22)-KDM4A is an E3 ubiquitin ligase that targets methylated p53 and regulates key senescent processes.
26755726 KDM4A is regulated by hsa-mir-23a-3p, hsa-mir-23b-3p, and hsa-mir-137.
26731476 these data reveal a JMJD2A/ETV1/YAP1 axis that promotes prostate cancer initiation and that may be a suitable target for therapeutic inhibition.
26729372 This study showed that KDM4A interacts with RNA Polymerase I, associates with active ribosomal RNA genes and is required for serum-induced activation of rDNA transcription.
26498874 Study demonstrates that JMJD2A contributes to tumorigenesis in non-small cell lung cancer (NSCLC) by regulating miR-150. Additionally, JMJD2A overexpression is associated with a poor prognosis for NSCLC patients.
26397136 High KDM4A expression is associated with endometrial cancer progression.
25945750 Jra recruits the HP1a/KDM4A complex to its gene body region upon osmotic stress to reduce H3K36 methylation levels and disrupt H3K36 methylation-dependent histone deacetylation
25832587 Studies indicate that histone lysine demethylase (JmjC-KDM) KDM4A protein has been implicated in numerous cancers and cardiovascular diseases.
25660547 KDM4 mediates nutrient-limitation signaling that leads to the transcriptional induction of autophagy.
25633974 this review focuses on describing the structure, mechanisms, and function of KDM4A and primarily discusses the role of KDM4A in cancer development and the importance of KDM4A as a potential therapeutic target. [review]
More...

AA Sequence

MASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAP      1 - 70
IQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTL     71 - 140
YEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYS    141 - 210
VPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFN    211 - 280
HGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEA    281 - 350
AEFLKESELPPRAGNEEECPEEDMEGVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDL    351 - 420
SSEQYEMTECPAALAPVRPTHSSVRQVEDGLTFPDYSDSTEVKFEELKNVKLEEEDEEEEQAAAALDLSV    421 - 490
NPASVGGRLVFSGSKKKSSSSLGSGSSRDSISSDSETSEPLSCRAQGQTGVLTVHSYAKGDGRVTVGEPC    491 - 560
TRKKGSAARSFSERELAEVADEYMFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEA    561 - 630
EETEAWAKPLSQLWQNRPPNFEAEKEFNETMAQQAPHCAVCMIFQTYHQVEFGGFNQNCGNASDLAPQKQ    631 - 700
RTKPLIPEMCFTSTGCSTDINLSTPYLEEDGTSILVSCKKCSVRVHASCYGVPPAKASEDWMCSRCSANA    701 - 770
LEEDCCLCSLRGGALQRANDDRWVHVSCAVAILEARFVNIAERSPVDVSKIPLPRFKLKCIFCKKRRKRT    771 - 840
AGCCVQCSHGRCPTAFHVSCAQAAGVMMQPDDWPFVVFITCFRHKIPNLERAKGALQSITAGQKVISKHK    841 - 910
NGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVAS    911 - 980
HPIQMYQVEFEDGSQLVVKRDDVYTLDEELPKRVKSRLSVASDMRFNEIFTEKEVKQEKKRQRVINSRYR    981 - 1050
EDYIEPALYRAIME                                                           1051 - 1064
//

Text Mined References (63)

PMID Year Title
26868148 2016 SCF(Fbxo22)-KDM4A targets methylated p53 for degradation and regulates senescence.
26755726 2016 Regulation of Transient Site-specific Copy Gain by MicroRNA.
26731476 2016 Histone demethylase JMJD2A drives prostate tumorigenesis through transcription factor ETV1.
26729372 2016 The histone demethylase JMJD2A/KDM4A links ribosomal RNA transcription to nutrients and growth factors availability.
26498874 2016 Jumonji domain containing 2A predicts prognosis and regulates cell growth in lung cancer depending on miR-150.
26397136 2015 KDM4B and KDM4A promote endometrial cancer progression by regulating androgen receptor, c-myc, and p27kip1.
25945750 2015 HP1a/KDM4A is involved in the autoregulatory loop of the oncogene gene c-Jun.
25832587 2015 Epigenetic regulation by histone demethylases in hypoxia.
25660547 2015 Rph1/KDM4 mediates nutrient-limitation signaling that leads to the transcriptional induction of autophagy.
25633974 2015 The role of the histone demethylase KDM4A in cancer.
More...