Property Summary

NCBI Gene PubMed Count 31
PubMed Score 106.61
PubTator Score 71.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.200 2.1e-02
Breast cancer 2.500 2.6e-02
lung cancer 1.400 6.5e-03
malignant mesothelioma -1.200 2.9e-05
osteosarcoma 1.305 4.7e-04
ovarian cancer -1.600 1.4e-05
spina bifida -1.758 4.0e-02
subependymal giant cell astrocytoma -1.832 1.9e-02

Synonym

Accession O75159 Q53SD4 Q8IYZ4 SOCS-5
Symbols CIS6
CISH6
Cish5
SOCS-5

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (2)

Gene RIF (14)

AA Sequence

MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCLSVKEKNISIGDSTPQQQSSPLRENIALQLGLS      1 - 70
PSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPWGGKKKHSCSTKTQSSLDADK     71 - 140
KFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQRLQDTVGLCFPMRTYSKQSKPLFSNKRKIHL    141 - 210
SELMLEKCPFPAGSDLAQKWHLIKQHTAPVSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPP    211 - 280
NAQIHTFEATAQVNPLYKLGPKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTH    281 - 350
VSRQGAWKVHTQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR    351 - 420
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTFPFSLQYICRA    421 - 490
VICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK                            491 - 536
//

Text Mined References (33)

PMID Year Title