Property Summary

NCBI Gene PubMed Count 28
Grant Count 6
R01 Count 4
Funding $348,730.14
PubMed Score 102.45
PubTator Score 71.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
astrocytic glioma -1.200 0.021
osteosarcoma 1.908 0.000
lung cancer 1.400 0.007
Breast cancer 2.500 0.026
subependymal giant cell astrocytoma -2.861 0.006
spina bifida -1.758 0.040
ovarian cancer -1.600 0.000

 GO Component (1)

Gene RIF (11)

PMID Text
25017311 Opisthorchis felineus infection diminishes the risk of atopic bronchial asthma associated with the SOCS5 gene polymorphism.
24340963 The rs6737848 SOCS5 polymorphism was significantly associated with asthma in additive model and in dominant model
23990909 different domains in SOCS5 contribute to two distinct mechanisms for regulation of cytokine and growth factor signaling with JAK1 and SHC-1
22773185 Exogenous miR-9 effectively reduced SOCS5 levels, leading to activated JAK-STAT pathway, which promoted endothelial cell migration and tumour angiogenesis
22423360 Identified is a conserved region of about 70 residues in the N-terminal domains of SOCS4 and 5 that is predicted to be more ordered than the surrounding sequence.
22081311 The results may contribute to understanding SOCS5 and SOCS6 expression regulation in various cancer tissues, and show that these two factors may be used for diagnosing cancer.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20802378 Observational study of genetic testing. (HuGE Navigator)
20137421 Up regulation of SOCS1 and SOCS5 expression and down-regulation of SOCS3 and CIS may correlate with the development of a Th1 mediated immune response in Vogt-Koyanagi-Harada disease.
16210657 Constitutive expression of SOCS5 in transgenic mice results in reduced eosinophil infiltration in allergic conjunctivitis
More...

AA Sequence

MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCLSVKEKNISIGDSTPQQQSSPLRENIALQLGLS      1 - 70
PSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPWGGKKKHSCSTKTQSSLDADK     71 - 140
KFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQRLQDTVGLCFPMRTYSKQSKPLFSNKRKIHL    141 - 210
SELMLEKCPFPAGSDLAQKWHLIKQHTAPVSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPP    211 - 280
NAQIHTFEATAQVNPLYKLGPKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTH    281 - 350
VSRQGAWKVHTQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR    351 - 420
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTFPFSLQYICRA    421 - 490
VICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK                            491 - 536
//

Text Mined References (30)

PMID Year Title
25017311 2014 Opisthorchis felineus liver fluke invasion is an environmental factor modifying genetic risk of atopic bronchial asthma.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
24340963 2013 [Association of polymorphism Rs6737848 in the Socs5 gene with bronchial asthma].
24255059 2014 Inhibition of microRNA-92a prevents endothelial dysfunction and atherosclerosis in mice.
23990909 2013 Suppressor of Cytokine Signaling (SOCS) 5 utilises distinct domains for regulation of JAK1 and interaction with the adaptor protein Shc-1.
22773185 2012 Tumour-secreted miR-9 promotes endothelial cell migration and angiogenesis by activating the JAK-STAT pathway.
22423360 2012 The N-terminal domains of SOCS proteins: a conserved region in the disordered N-termini of SOCS4 and 5.
22081311 2012 SOCS5 and SOCS6 have similar expression patterns in normal and cancer tissues.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
More...