Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.64
PubTator Score 0.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -1.700 7.2e-04
Amyotrophic lateral sclerosis 1.130 6.3e-06
Astrocytoma, Pilocytic -1.600 4.4e-06
atypical teratoid / rhabdoid tumor -1.800 3.5e-05
autosomal dominant Emery-Dreifuss muscul... 1.160 3.0e-03
colon cancer -1.800 8.3e-04
glioblastoma -1.400 8.7e-06
group 4 medulloblastoma -1.200 2.3e-03
hepatocellular carcinoma -1.100 9.9e-04
intraductal papillary-mucinous neoplasm ... 1.200 2.1e-02
juvenile dermatomyositis 1.107 1.7e-08
lung cancer -1.200 3.0e-03
malignant mesothelioma 1.900 1.6e-06
medulloblastoma, large-cell -1.700 3.8e-03
Multiple myeloma 1.264 3.5e-03
osteosarcoma 1.393 4.2e-05
ovarian cancer 1.800 4.2e-04
Pick disease -1.100 1.5e-02
psoriasis -1.500 9.7e-05
Rheumatoid arthritis 1.100 2.2e-02
spina bifida -2.546 2.7e-02
tuberculosis 1.100 3.6e-02

Synonym

Accession O75157 D3DNI5 Q6PI50 Q9H2Z6 Q9H2Z7 Q9H2Z8
Symbols TILZ4a
TILZ4b
TILZ4c

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (3)

AA Sequence

MSKMPAKKKSCFQITSVTTAQVATSITEDTESLDDPDESRTEDVSSEIFDVSRATDYGPEEVCERSSSEE      1 - 70
TLNNVGDAETPGTVSPNLLLDGQLAAAAAAPANGGGVVSARSVSGALASTLAAAATSAPAPGAPGGPQLA     71 - 140
GSSAGPVTAAPSQPPTTCSSRFRVIKLDHGSGEPYRRGRWTCMEYYERDSDSSVLTRSGDCIRHSSTFDQ    141 - 210
TAERDSGLGATGGSVVVVVASMQGAHGPESGTDSSLTAVSQLPPSEKMSQPTPAQPQSFSVGQPQPPPPP    211 - 280
VGGAVAQSSAPLPPFPGAATGPQPMMAAAQPSQPQGAGPGGQTLPPTNVTLAQPAMSLPPQPGPAVGAPA    281 - 350
AQQPQQFAYPQPQIPPGHLLPVQPSGQSEYLQQHVAGLQPPSPAQPSSTGAAASPATAATLPVGTGQNAS    351 - 420
SVGAQLMGASSQPSEAMAPRTGPAQGGQVAPCQPTGVPPATVGGVVQPCLGPAGAGQPQSVPPPQMGGSG    421 - 490
PLSAVPGGPHAVVPGVPNVPAAVPAPSVPSVSTTSVTMPNVPAPLAQSQQLSSHTPVSRSSSIIQHVGLP    491 - 560
LAPGTHSAPTSLPQSDLSQFQTQTQPLVGQVDDTRRKSEPLPQPPLSLIAENKPVVKPPVADSLANPLQL    561 - 630
TPMNSLATSVFSIAIPVDGDEDRNPSTAFYQAFHLNTLKESKSLWDSASGGGVVAIDNKIEQAMDLVKSH    631 - 700
LMYAVREEVEVLKEQIKELVERNSLLERENALLKSLSSNDQLSQLPTQQANPGSTSQQQAVIAQPPQPTQ    701 - 770
PPQQPNVSSA                                                                771 - 780
//

Text Mined References (13)

PMID Year Title