Property Summary

NCBI Gene PubMed Count 10
PubMed Score 386.66
PubTator Score 54.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 2.3e-03
Breast cancer -1.100 1.2e-03
colon cancer -1.200 1.4e-02
ependymoma -1.400 3.9e-02
glioblastoma -1.200 3.3e-04
group 4 medulloblastoma -1.200 5.7e-04
intraductal papillary-mucinous adenoma (... -1.500 1.3e-04
intraductal papillary-mucinous carcinoma... -1.900 2.6e-03
intraductal papillary-mucinous neoplasm ... -2.000 5.7e-04
ovarian cancer -1.700 1.1e-06
psoriasis -2.000 4.5e-05

Gene RIF (7)

AA Sequence

MSTAAFHISSLLEKMTSSDKDFRFMATSDLMSELQKDSIQLDEDSERKVVKMLLRLLEDKNGEVQNLAVK      1 - 70
CLGPLVVKVKEYQVETIVDTLCTNMRSDKEQLRDIAGIGLKTVLSELPPAATGSGLATNVCRKITGQLTS     71 - 140
AIAQQEDVAVQLEALDILSDMLSRLGVPLGAFHASLLHCLLPQLSSPRLAVRKRAVGALGHLAAACSTDL    141 - 210
FVELADHLLDRLPGPRVPTSPTAIRTLIQCLGSVGRQAGHRLGAHLDRLVPLVEDFCNLDDDELRESCLQ    211 - 280
AFEAFLRKCPKEMGPHVPNVTSLCLQYIKHDPNYNYDSDEDEEQMETEDSEFSEQESEDEYSDDDDMSWK    281 - 350
VRRAAAKCIAALISSRPDLLPDFHCTLAPVLIRRFKEREENVKADVFTAYIVLLRQTQPPKGWLEAMEEP    351 - 420
TQTGSNLHMLRGQVPLVVKALQRQLKDRSVRARQGCFSLLTELAGVLPGSLAEHMPVLVSGIIFSLADRS    421 - 490
SSSTIRMDALAFLQGLLGTEPAEAFHPHLPILLPPVMACVADSFYKIAAEALVVLQELVRALWPLHRPRM    491 - 560
LDPEPYVGEMSAVTLARLRATDLDQEVKERAISCMGHLVGHLGDRLGDDLEPTLLLLLDRLRNEITRLPA    561 - 630
IKALTLVAVSPLQLDLQPILAEALHILASFLRKNQRALRLATLAALDALAQSQGLSLPPSAVQAVLAELP    631 - 700
ALVNESDMHVAQLAVDFLATVTQAQPASLVEVSGPVLSELLRLLRSPLLPAGVLAAAEGFLQALVGTRPP    701 - 770
CVDYAKLISLLTAPVYEQAVDGGPGLHKQVFHSLARCVAALSAACPQEAASTASRLVCDARSPHSSTGVK    771 - 840
VLAFLSLAEVGQVAGPGHQRELKAVLLEALGSPSEDVRAAASYALGRVGAGSLPDFLPFLLEQIEAEPRR    841 - 910
QYLLLHSLREALGAAQPDSLKPYAEDIWALLFQRCEGAEEGTRGVVAECIGKLVLVNPSFLLPRLRKQLA    911 - 980
AGRPHTRSTVITAVKFLISDQPHPIDPLLKSFIGEFMESLQDPDLNVRRATLAFFNSAVHNKPSLVRDLL    981 - 1050
DDILPLLYQETKIRRDLIREVEMGPFKHTVDDGLDVRKAAFECMYSLLESCLGQLDICEFLNHVEDGLKD   1051 - 1120
HYDIRMLTFIMVARLATLCPAPVLQRVDRLIEPLRATCTAKVKAGSVKQEFEKQDELKRSAMRAVAALLT   1121 - 1190
IPEVGKSPIMADFSSQIRSNPELAALFESIQKDSASAPSTDSMELS                           1191 - 1236
//

Text Mined References (12)

PMID Year Title