Property Summary

NCBI Gene PubMed Count 9
Grant Count 14
R01 Count 11
Funding $1,291,339.67
PubMed Score 368.88
PubTator Score 54.29

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
22613845 results suggest that MyoD and TIP120B potentiate each other at gene expression and post-translation levels, respectively, which may promote myogenesis cooperatively
22190034 HIV-1 IN is identified to have a physical interaction with Cullin-associated and neddylation-dissociated 2 (CAND2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19159115 Based on these results it is unlikely CAND2 and WNT7a are the major genes that causes clubfoot.
19159115 Observational study of gene-disease association. (HuGE Navigator)
12692129 TIP120B is a specific substrate of KIAA10; both are highly expressed in human skeletal muscle, suggesting that KIAA10 may regulate TIP120B homeostasis specifically in this tissue.
12207886 TIP120B was induced in C2C12 myoblasts when these cells differentiated into myotubes (TIP120B).

AA Sequence

MSTAAFHISSLLEKMTSSDKDFRFMATSDLMSELQKDSIQLDEDSERKVVKMLLRLLEDKNGEVQNLAVK      1 - 70
CLGPLVVKVKEYQVETIVDTLCTNMRSDKEQLRDIAGIGLKTVLSELPPAATGSGLATNVCRKITGQLTS     71 - 140
AIAQQEDVAVQLEALDILSDMLSRLGVPLGAFHASLLHCLLPQLSSPRLAVRKRAVGALGHLAAACSTDL    141 - 210
FVELADHLLDRLPGPRVPTSPTAIRTLIQCLGSVGRQAGHRLGAHLDRLVPLVEDFCNLDDDELRESCLQ    211 - 280
AFEAFLRKCPKEMGPHVPNVTSLCLQYIKHDPNYNYDSDEDEEQMETEDSEFSEQESEDEYSDDDDMSWK    281 - 350
VRRAAAKCIAALISSRPDLLPDFHCTLAPVLIRRFKEREENVKADVFTAYIVLLRQTQPPKGWLEAMEEP    351 - 420
TQTGSNLHMLRGQVPLVVKALQRQLKDRSVRARQGCFSLLTELAGVLPGSLAEHMPVLVSGIIFSLADRS    421 - 490
SSSTIRMDALAFLQGLLGTEPAEAFHPHLPILLPPVMACVADSFYKIAAEALVVLQELVRALWPLHRPRM    491 - 560
LDPEPYVGEMSAVTLARLRATDLDQEVKERAISCMGHLVGHLGDRLGDDLEPTLLLLLDRLRNEITRLPA    561 - 630
IKALTLVAVSPLQLDLQPILAEALHILASFLRKNQRALRLATLAALDALAQSQGLSLPPSAVQAVLAELP    631 - 700
ALVNESDMHVAQLAVDFLATVTQAQPASLVEVSGPVLSELLRLLRSPLLPAGVLAAAEGFLQALVGTRPP    701 - 770
CVDYAKLISLLTAPVYEQAVDGGPGLHKQVFHSLARCVAALSAACPQEAASTASRLVCDARSPHSSTGVK    771 - 840
VLAFLSLAEVGQVAGPGHQRELKAVLLEALGSPSEDVRAAASYALGRVGAGSLPDFLPFLLEQIEAEPRR    841 - 910
QYLLLHSLREALGAAQPDSLKPYAEDIWALLFQRCEGAEEGTRGVVAECIGKLVLVNPSFLLPRLRKQLA    911 - 980
AGRPHTRSTVITAVKFLISDQPHPIDPLLKSFIGEFMESLQDPDLNVRRATLAFFNSAVHNKPSLVRDLL    981 - 1050
DDILPLLYQETKIRRDLIREVEMGPFKHTVDDGLDVRKAAFECMYSLLESCLGQLDICEFLNHVEDGLKD   1051 - 1120
HYDIRMLTFIMVARLATLCPAPVLQRVDRLIEPLRATCTAKVKAGSVKQEFEKQDELKRSAMRAVAALLT   1121 - 1190
IPEVGKSPIMADFSSQIRSNPELAALFESIQKDSASAPSTDSMELS                           1191 - 1236
//

Text Mined References (11)

PMID Year Title
22613845 2012 Interplay between two myogenesis-related proteins: TBP-interacting protein 120B and MyoD.
21269460 2011 Initial characterization of the human central proteome.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
19159115 2009 Evaluation of CAND2 and WNT7a as candidate genes for congenital idiopathic clubfoot.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12692129 2003 Proteolytic targeting of transcriptional regulator TIP120B by a HECT domain E3 ligase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12207886 2002 TBP-interacting protein 120B, which is induced in relation to myogenesis, binds to NOT3.
10441524 1999 TIP120B: a novel TIP120-family protein that is expressed specifically in muscle tissues.
More...