Property Summary

NCBI Gene PubMed Count 30
PubMed Score 5.58
PubTator Score 7.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Venous Thromboembolism 34
Disease Target Count P-value
juvenile dermatomyositis 1189 7.08136756261962E-13
ovarian cancer 8492 3.17882072400983E-12
acute quadriplegic myopathy 1157 3.7016381008097E-9
Amyotrophic Lateral Sclerosis 432 2.4655313211181E-7
posterior fossa group B ependymoma 1530 2.23469303279622E-6
Pick disease 1893 1.52967066810443E-4
glioblastoma 5572 4.72098714790157E-4
pediatric high grade glioma 2712 8.59881842531682E-4
oligodendroglioma 2849 0.00149463779099503
astrocytic glioma 2241 0.00346845207759272
medulloblastoma, large-cell 6234 0.0043191206308484
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00494676882930511
adrenocortical adenoma 134 0.010246910228195
group 4 medulloblastoma 1875 0.0113252153898685
non primary Sjogren syndrome sicca 840 0.0128464456307274
progressive supranuclear palsy 674 0.0139237857473377
atypical teratoid / rhabdoid tumor 4369 0.0169175718492463
gastric carcinoma 832 0.029510492557983
nephrosclerosis 329 0.0346999136785987

Expression

Synonym

Gene

PDB

4UJ3   4UJ4   2D7C   2HV8   4D0M  

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (9)

PMID Text
25673879 Rab11-FIP3 coordinates the interactions of ASAP1 and Rab11a with Rabin8.
20736163 CART1 might be a cytoplasmic, testis-specific derepressor of RAR
20214888 FIP3 was identified as the first membrane-associated interacting-partner for DLIC-2.
19327867 Rab11-FIP3 is a Rab11-binding protein that regulates breast cancer cell motility by modulating the actin cytoskeleton.(325-41)
17628206 FIP3 is a scaffolding protein that, in addition to regulating endosome targeting to the cleavage furrow, also is required for Arf6 recruitment to the midbody during late telophase.
17394487 Necessary for the structural integrity of the pericentrosomal endosomal recycling compartment.
17030804 Results describe the distinct C-terminal binding regions of FIP3 and FIP4 for Rab11 and ARF5/ARF6, and the crystal structure of Rab11 in complex with the Rab11-binding domain (RBD) of FIP3.
15601896 FIP-3 and RAB11 protein complex regulates recycling endosomes targeting to the cleavage furrow during late cytokinesis.
15158446 Rab11-FIP3 localises to a Rab11-positive pericentrosomal compartment during interphase and to the cleavage furrow during cytokinesis

AA Sequence

MASAPPASPPGSEPPGPDPEPGGPDGPGAAQLAPGPAELRLGAPVGGPDPQSPGLDEPAPGAAADGGARW      1 - 70
SAGPAPGLEGGPRDPGPSAPPPRSGPRGQLASPDAPGPGPRSEAPLPELDPLFSWTEEPEECGPASCPES     71 - 140
APFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQEDGPRLRAV    141 - 210
FDALDGDGDGFVRIEDFIQFATVYGAEQVKDLTKYLDPSGLGVISFEDFYQGITAIRNGDPDGQCYGGVA    211 - 280
SAQDEEPLACPDEFDDFVTYEANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDADSAGGSAV    281 - 350
PSECLDAMEEPDHGALLLLPGRPHPHGQSVITVIGGEEHFEDYGEGSEAELSPETLCNGQLGCSDPAFLT    351 - 420
PSPTKRLSSKKVARYLHQSGALTMEALEDPSPELMEGPEEDIADKVVFLERRVLELEKDTAATGEQHSRL    421 - 490
RQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIEIENLQTRLQQLDEENSELRS    491 - 560
CTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRMGDRLSHERHQFQRDKEATQELIEDLRKQLE    561 - 630
HLQLLKLEAEQRRGRSSSMGLQEYHSRARESELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLF    631 - 700
STAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEVK                  701 - 756
//

Text Mined References (34)

PMID Year Title
25673879 2015 The Arf and Rab11 effector FIP3 acts synergistically with ASAP1 to direct Rabin8 in ciliary receptor targeting.
25272277 2014 A Ras-like domain in the light intermediate chain bridges the dynein motor to a cargo-binding region.
24040321 2013 The rab11 effector protein FIP1 regulates adiponectin trafficking and secretion.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22401586 2012 Rab11-FIP3 is a cell cycle-regulated phosphoprotein.
20736163 2010 A novel cytoplasmic adaptor for retinoic acid receptor (RAR) and thyroid receptor functions as a Derepressor of RAR in the absence of retinoic acid.
20214888 2010 Rab11-FIP3 binds dynein light intermediate chain 2 and its overexpression fragments the Golgi complex.
19327867 2009 Rab11-FIP3 is a Rab11-binding protein that regulates breast cancer cell motility by modulating the actin cytoskeleton.
18511905 2008 Sequential Cyk-4 binding to ECT2 and FIP3 regulates cleavage furrow ingression and abscission during cytokinesis.
More...