Property Summary

NCBI Gene PubMed Count 32
PubMed Score 6.62
PubTator Score 7.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 1.606 3.7e-09
adrenocortical adenoma 1.259 1.0e-02
Amyotrophic lateral sclerosis 1.478 2.5e-07
astrocytic glioma 1.700 3.5e-03
atypical teratoid / rhabdoid tumor -1.300 1.7e-02
ependymoma -1.400 1.9e-05
gastric carcinoma 1.400 3.0e-02
glioblastoma -1.700 4.7e-04
group 4 medulloblastoma -1.200 1.1e-02
juvenile dermatomyositis 1.286 7.1e-13
medulloblastoma, large-cell -1.900 4.3e-03
nephrosclerosis -1.122 3.5e-02
non primary Sjogren syndrome sicca -1.200 1.3e-02
oligodendroglioma 2.300 1.5e-03
ovarian cancer -4.000 3.2e-12
pancreatic ductal adenocarcinoma liver m... 1.472 4.9e-03
pediatric high grade glioma -1.300 8.6e-04
Pick disease 1.100 1.5e-04
progressive supranuclear palsy 1.100 1.4e-02

Gene RIF (11)

AA Sequence

MASAPPASPPGSEPPGPDPEPGGPDGPGAAQLAPGPAELRLGAPVGGPDPQSPGLDEPAPGAAADGGARW      1 - 70
SAGPAPGLEGGPRDPGPSAPPPRSGPRGQLASPDAPGPGPRSEAPLPELDPLFSWTEEPEECGPASCPES     71 - 140
APFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQEDGPRLRAV    141 - 210
FDALDGDGDGFVRIEDFIQFATVYGAEQVKDLTKYLDPSGLGVISFEDFYQGITAIRNGDPDGQCYGGVA    211 - 280
SAQDEEPLACPDEFDDFVTYEANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDADSAGGSAV    281 - 350
PSECLDAMEEPDHGALLLLPGRPHPHGQSVITVIGGEEHFEDYGEGSEAELSPETLCNGQLGCSDPAFLT    351 - 420
PSPTKRLSSKKVARYLHQSGALTMEALEDPSPELMEGPEEDIADKVVFLERRVLELEKDTAATGEQHSRL    421 - 490
RQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIEIENLQTRLQQLDEENSELRS    491 - 560
CTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRMGDRLSHERHQFQRDKEATQELIEDLRKQLE    561 - 630
HLQLLKLEAEQRRGRSSSMGLQEYHSRARESELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLF    631 - 700
STAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEVK                  701 - 756
//

Text Mined References (37)

PMID Year Title