Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.88
PubTator Score 0.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.198 0.016
intraductal papillary-mucinous neoplasm ... 1.300 0.020
ovarian cancer -1.600 0.000

Synonym

Accession O75152 Q6AHY4 Q6AHY9 Q6AW79 Q6AWA1 Q6PJK4 Q86XZ7
Symbols ZC3HDC11A

Gene

PANTHER Protein Class (1)

 GWAS Trait (1)

Gene RIF (2)

PMID Text
22928037 PDIP3 and ZC11A associate with the human TREX complex in an ATP-dependent manner and function in mRNA export.
19536175 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPNQGEDCYFFFYSTCTKGDSCPFRHCEAAIGNETVCTLWQEGRCFRQVCRFRHMEIDKKRSEIPCYWEN      1 - 70
QPTGCQKLNCAFHHNRGRYVDGLFLPPSKTVLPTVPESPEEEVKASQLSVQQNKLSVQSNPSPQLRSVMK     71 - 140
VESSENVPSPTHPPVVINAADDDEDDDDQFSEEGDETKTPTLQPTPEVHNGLRVTSVRKPAVNIKQGECL    141 - 210
NFGIKTLEEIKSKKMKEKSKKQGEGSSGVSSLLLHPEPVPGPEKENVRTVVRTVTLSTKQGEEPLVRLSL    211 - 280
TERLGKRKFSAGGDSDPPLKRSLAQRLGKKVEAPETNIDKTPKKAQVSKSLKERLGMSADPDNEDATDKV    281 - 350
NKVGEIHVKTLEEILLERASQKRGELQTKLKTEGPSKTDDSTSGARSSSTIRIKTFSEVLAEKKHRQQEA    351 - 420
ERQKSKKDTTCIKLKIDSEIKKTVVLPPIVASRGQSEEPAGKTKSMQEVHIKTLEEIKLEKALRVQQSSE    421 - 490
SSTSSPSQHEATPGARRLLRITKRTGMKEEKNLQEGNEVDSQSSIRTEAKEASGETTGVDITKIQVKRCE    491 - 560
TMREKHMQKQQEREKSVLTPLRGDVASCNTQVAEKPVLTAVPGITRHLTKRLPTKSSQKVEVETSGIGDS    561 - 630
LLNVKCAAQTLEKRGKAKPKVNVKPSVVKVVSSPKLAPKRKAVEMHAAVIAAVKPLSSSSVLQEPPAKKA    631 - 700
AVAVVPLVSEDKSVTVPEAENPRDSLVLPPTQSSSDSSPPEVSGPSSSQMSMKTRRLSSASTGKPPLSVE    701 - 770
DDFEKLIWEISGGKLEAEIDLDPGKDEDDLLLELSEMIDS                                  771 - 810
//

Text Mined References (30)

PMID Year Title
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25038754 2014 Genome-wide association analysis in East Asians identifies breast cancer susceptibility loci at 1q32.1, 5q14.3 and 15q26.1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22928037 2012 The proteins PDIP3 and ZC11A associate with the human TREX complex in an ATP-dependent manner and function in mRNA export.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...