Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.14
PubTator Score 13.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma -1.203 0.004
astrocytoma 1.100 0.007
group 3 medulloblastoma 1.100 0.004
subependymal giant cell astrocytoma -1.206 0.017
lung adenocarcinoma -1.300 0.000

Synonym

Accession O75151 Q4VXG0 Q8N3K2 Q9Y6N4
Symbols GRC5
KDM7C
JHDM1E
CENP-35

Gene

PDB

3KQI   3PTR   3PU3   3PU8   3PUA   3PUS  

Gene RIF (7)

PMID Text
25204660 PHF2 is likely to repress rDNA transcription by competing with PHF8 for binding of ribosomal DNA promoter and by recruiting H3K9me2/3 methyltransferase SUV39H1.
25043306 PHF2 acts as a tumor suppressor in association with p53 in cancer development and ensures p53-mediated cell death in response to chemotherapy.
22534467 JARID1B and PHF2 are overexpressed in esophageal squamous cell carcinoma (ESCC) and they may play crucial roles in the course of ESCC initiation and/or progression
21167174 the crystal structures of PHF2 Jumonji domain in the absence and presence of additional exogenous metal ions were determined.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18990233 Differential association of alterations in FANCC and PTCH1 with that of PHF2, XPA and two breast cancer susceptibility genes (BRCA1/BRCA2) in the two age groups suggests differences in their molecular pathogenesis.
18854154 Knockdown of PHD finger protein 2 (PHF2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRTWHK      1 - 70
HGPGQAPDVKPVQNGSQLFIKELRSRTFPSAEDVVARVPGSQLTLGYMEEHGFTEPILVPKKDGLGLAVP     71 - 140
APTFYVSDVENYVGPERSVDVTDVTKQKDCKMKLKEFVDYYYSTNRKRVLNVTNLEFSDTRMSSFVEPPD    141 - 210
IVKKLSWVENYWPDDALLAKPKVTKYCLICVKDSYTDFHIDSGGASAWYHVLKGEKTFYLIRPASANISL    211 - 280
YERWRSASNHSEMFFADQVDKCYKCIVKQGQTLFIPSGWIYATLTPVDCLAFAGHFLHSLSVEMQMRAYE    281 - 350
VERRLKLGSLTQFPNFETACWYMGKHLLEAFKGSHKSGKQLPPHLVQGAKILNGAFRSWTKKQALAEHED    351 - 420
ELPEHFKPSQLIKDLAKEIRLSENASKAVRPEVNTVASSDEVCDGDREKEEPPSPIEATPPQSLLEKVSK    421 - 490
KKTPKTVKMPKPSKIPKPPKPPKPPRPPKTLKLKDGGKKKGKKSRESASPTIPNLDLLEAHTKEALTKME    491 - 560
PPKKGKATKSVLSVPNKDVVHMQNDVERLEIREQTKSKSEAKWKYKNSKPDSLLKMEEEQKLEKSPLAGN    561 - 630
KDNKFSFSFSNKKLLGSKALRPPTSPGVFGALQNFKEDKPKPVRDEYEYVSDDGELKIDEFPIRRKKNAP    631 - 700
KRDLSFLLDKKAVLPTPVTKPKLDSAAYKSDDSSDEGSLHIDTDTKPGRNARVKKESGSSAAGILDLLQA    701 - 770
SEEVGALEYNPSSQPPASPSTQEAIQGMLSMANLQASDSCLQTTWGAGQAKGSSLAAHGARKNGGGSGKS    771 - 840
AGKRLLKRAAKNSVDLDDYEEEQDHLDACFKDSDYVYPSLESDEDNPIFKSRSKKRKGSDDAPYSPTARV    841 - 910
GPSVPRQDRPVREGTRVASIETGLAAAAAKLSQQEEQKSKKKKSAKRKLTPNTTSPSTSTSISAGTTSTS    911 - 980
TTPASTTPASTTPASTSTASSQASQEGSSPEPPPESHSSSLADHEYTAAGTFTGAQAGRTSQPMAPGVFL    981 - 1050
TQRRPSASSPNNNTAAKGKRTKKGMATAKQRLGKILKIHRNGKLLL                           1051 - 1096
//

Text Mined References (24)

PMID Year Title
25204660 2014 PHD finger protein 2 (PHF2) represses ribosomal RNA gene transcription by antagonizing PHF finger protein 8 (PHF8) and recruiting methyltransferase SUV39H1.
25043306 2015 PHF2 histone demethylase acts as a tumor suppressor in association with p53 in cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22534467 2013 Overexpression of Jumonji AT-rich interactive domain 1B and PHD finger protein 2 is involved in the progression of esophageal squamous cell carcinoma.
21532585 2011 PKA-dependent regulation of the histone lysine demethylase complex PHF2-ARID5B.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21167174 2011 Structural basis for human PHF2 Jumonji domain interaction with metal ions.
20813266 2010 The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...