Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.14
PubTator Score 13.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Neurodevelopmental Disorders 70 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.100 7.2e-03
group 3 medulloblastoma 1.100 4.1e-03
lung adenocarcinoma -1.300 4.2e-19
malignant mesothelioma 1.100 5.8e-06
osteosarcoma -1.203 3.9e-03
subependymal giant cell astrocytoma -1.206 1.7e-02

Protein-protein Interaction (1)

Gene RIF (7)

AA Sequence

MATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRTWHK      1 - 70
HGPGQAPDVKPVQNGSQLFIKELRSRTFPSAEDVVARVPGSQLTLGYMEEHGFTEPILVPKKDGLGLAVP     71 - 140
APTFYVSDVENYVGPERSVDVTDVTKQKDCKMKLKEFVDYYYSTNRKRVLNVTNLEFSDTRMSSFVEPPD    141 - 210
IVKKLSWVENYWPDDALLAKPKVTKYCLICVKDSYTDFHIDSGGASAWYHVLKGEKTFYLIRPASANISL    211 - 280
YERWRSASNHSEMFFADQVDKCYKCIVKQGQTLFIPSGWIYATLTPVDCLAFAGHFLHSLSVEMQMRAYE    281 - 350
VERRLKLGSLTQFPNFETACWYMGKHLLEAFKGSHKSGKQLPPHLVQGAKILNGAFRSWTKKQALAEHED    351 - 420
ELPEHFKPSQLIKDLAKEIRLSENASKAVRPEVNTVASSDEVCDGDREKEEPPSPIEATPPQSLLEKVSK    421 - 490
KKTPKTVKMPKPSKIPKPPKPPKPPRPPKTLKLKDGGKKKGKKSRESASPTIPNLDLLEAHTKEALTKME    491 - 560
PPKKGKATKSVLSVPNKDVVHMQNDVERLEIREQTKSKSEAKWKYKNSKPDSLLKMEEEQKLEKSPLAGN    561 - 630
KDNKFSFSFSNKKLLGSKALRPPTSPGVFGALQNFKEDKPKPVRDEYEYVSDDGELKIDEFPIRRKKNAP    631 - 700
KRDLSFLLDKKAVLPTPVTKPKLDSAAYKSDDSSDEGSLHIDTDTKPGRNARVKKESGSSAAGILDLLQA    701 - 770
SEEVGALEYNPSSQPPASPSTQEAIQGMLSMANLQASDSCLQTTWGAGQAKGSSLAAHGARKNGGGSGKS    771 - 840
AGKRLLKRAAKNSVDLDDYEEEQDHLDACFKDSDYVYPSLESDEDNPIFKSRSKKRKGSDDAPYSPTARV    841 - 910
GPSVPRQDRPVREGTRVASIETGLAAAAAKLSQQEEQKSKKKKSAKRKLTPNTTSPSTSTSISAGTTSTS    911 - 980
TTPASTTPASTTPASTSTASSQASQEGSSPEPPPESHSSSLADHEYTAAGTFTGAQAGRTSQPMAPGVFL    981 - 1050
TQRRPSASSPNNNTAAKGKRTKKGMATAKQRLGKILKIHRNGKLLL                           1051 - 1096
//

Text Mined References (25)

PMID Year Title