Property Summary

NCBI Gene PubMed Count 28
PubMed Score 37.76
PubTator Score 56.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
pituitary cancer 1972 3.86136191934793E-10
malignant mesothelioma 3163 4.73944594530821E-6
tuberculosis 1563 7.26547333482503E-6
osteosarcoma 7933 4.04592722022598E-5
adrenocortical carcinoma 1427 1.87534119760293E-4
medulloblastoma, large-cell 6234 3.3124205559255E-4
atypical teratoid/rhabdoid tumor 1095 5.04481692420776E-4
chronic lymphocytic leukemia 244 5.86225311294842E-4
pilocytic astrocytoma 3086 0.00194173828153307
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00263894347907054
oligodendroglioma 2849 0.0105844087580886
subependymal giant cell astrocytoma 2287 0.020695476279651
Disease Target Count Z-score Confidence
Parkinson's disease 364 3.496 1.7
Huntington's disease 72 3.33 1.7

Expression

  Differential Expression (12)

Synonym

Accession O75146 A6NHQ6 Q6NXG8 Q9UED9 HIP1-related protein
Symbols HIP3
HIP12
ILWEQ

Gene

PDB

1R0D  

  Ortholog (13)

Gene RIF (17)

PMID Text
26341140 We conclude that HIP1R expression is strongly indicative of survival in diffuse large B-cell lymphoma
25818163 our findings support the conclusion that the rs12817488 in CCDC62/HIP1R polymorphism may increase the risk of Parkinson's disease in the Chinese Han population.
24312176 STK39 (rs2102808) and CCDC62/HIP1R (rs12817488) do not appear to influence PD risk.
21189155 HIP1r plays an important role in regulating the attachment of spindle microtubules to chromosomes during mitosis, an event that is required for accurate congression and segregation of chromosomes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19255499 This study provided the previously unknown function of HIP1R involved in the intrinsic cell death pathway and further explored possible mechanisms by which HIP1R induces cell death.
18790740 Actin binding by Hip1 (huntingtin-interacting protein 1) and Hip1R (Hip1-related protein) is regulated by clathrin light chain
18187620 Knockdown of huntingtin interacting protein 1 related (HIP1R) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18165318 in mammalian cells CLCs function in intracellular membrane trafficking by acting as recruitment proteins for HIP1R, enabling HIP1R to regulate actin assembly on clathrin-coated structures
17928447 Neuronal dysfunction in transgenic Caenorhabditis elegans expressing mutant N-terminal huntingtin is specifically enhanced by hipr-1 loss of function.
More...

AA Sequence

MNSIKNVPARVLSRRPGHSLEAEREQFDKTQAISISKAINTQEAPVKEKHARRIILGTHHEKGAFTFWSY      1 - 70
AIGLPLPSSSILSWKFCHVLHKVLRDGHPNVLHDCQRYRSNIREIGDLWGHLHDRYGQLVNVYTKLLLTK     71 - 140
ISFHLKHPQFPAGLEVTDEVLEKAAGTDVNNIFQLTVEMFDYMDCELKLSESVFRQLNTAIAVSQMSSGQ    141 - 210
CRLAPLIQVIQDCSHLYHYTVKLLFKLHSCLPADTLQGHRDRFHEQFHSLRNFFRRASDMLYFKRLIQIP    211 - 280
RLPEGPPNFLRASALAEHIKPVVVIPEEAPEDEEPENLIEISTGPPAGEPVVVADLFDQTFGPPNGSVKD    281 - 350
DRDLQIESLKREVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLRHELAQLR    351 - 420
AAQLEGERSQGLREEAERKASATEARYNKLKEKHSELVHVHAELLRKNADTAKQLTVTQQSQEEVARVKE    421 - 490
QLAFQVEQVKRESELKLEEKSDQLEKLKRELEAKAGELARAQEALSHTEQSKSELSSRLDTLSAEKDALS    491 - 560
GAVRQREADLLAAQSLVRETEAALSREQQRSSQEQGELQGRLAERESQEQGLRQRLLDEQFAVLRGAAAE    561 - 630
AAGILQDAVSKLDDPLHLRCTSSPDYLVSRAQEALDAVSTLEEGHAQYLTSLADASALVAALTRFSHLAA    631 - 700
DTIINGGATSHLAPTDPADRLIDTCRECGARALELMGQLQDQQALRHMQASLVRTPLQGILQLGQELKPK    701 - 770
SLDVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTT    771 - 840
STSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEI    841 - 910
AASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTMDFSGLSLIKLKKQE    911 - 980
METQVRVLELEKTLEAERMRLGELRKQHYVLAGASGSPGEEVAIRPSTAPRSVTTKKPPLAQKPSVAPRQ    981 - 1050
DHQLDKKDGIYPAQLVNY                                                       1051 - 1068
//

Text Mined References (35)

PMID Year Title
26341140 2015 Low HIP1R mRNA and protein expression are associated with worse survival in diffuse large B-cell lymphoma patients treated with R-CHOP.
25818163 2015 The single nucleotide polymorphism Rs12817488 is associated with Parkinson's disease in the Chinese population.
24312176 2013 Genetic association study between STK39 and CCDC62/HIP1R and Parkinson's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21292315 2011 Imputation of sequence variants for identification of genetic risks for Parkinson's disease: a meta-analysis of genome-wide association studies.
21269460 2011 Initial characterization of the human central proteome.
21189155 2010 Huntingtin-interacting protein 1-related is required for accurate congression and segregation of chromosomes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20074057 2010 The Sla2p/HIP1/HIP1R family: similar structure, similar function in endocytosis?
More...