Property Summary

NCBI Gene PubMed Count 29
PubMed Score 38.56
PubTator Score 56.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma -1.236 1.9e-04
atypical teratoid/rhabdoid tumor -1.100 5.0e-04
Chronic Lymphocytic Leukemia -1.500 5.9e-04
intraductal papillary-mucinous carcinoma... 1.100 2.6e-03
malignant mesothelioma -1.200 4.7e-06
medulloblastoma, large-cell -1.500 3.3e-04
oligodendroglioma 1.700 1.1e-02
osteosarcoma -2.271 4.0e-05
Pilocytic astrocytoma 1.100 1.9e-03
pituitary cancer -2.100 3.9e-10
subependymal giant cell astrocytoma -1.140 4.8e-02
tuberculosis -1.400 7.3e-06

 IMPC Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (18)

AA Sequence

MNSIKNVPARVLSRRPGHSLEAEREQFDKTQAISISKAINTQEAPVKEKHARRIILGTHHEKGAFTFWSY      1 - 70
AIGLPLPSSSILSWKFCHVLHKVLRDGHPNVLHDCQRYRSNIREIGDLWGHLHDRYGQLVNVYTKLLLTK     71 - 140
ISFHLKHPQFPAGLEVTDEVLEKAAGTDVNNIFQLTVEMFDYMDCELKLSESVFRQLNTAIAVSQMSSGQ    141 - 210
CRLAPLIQVIQDCSHLYHYTVKLLFKLHSCLPADTLQGHRDRFHEQFHSLRNFFRRASDMLYFKRLIQIP    211 - 280
RLPEGPPNFLRASALAEHIKPVVVIPEEAPEDEEPENLIEISTGPPAGEPVVVADLFDQTFGPPNGSVKD    281 - 350
DRDLQIESLKREVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLRHELAQLR    351 - 420
AAQLEGERSQGLREEAERKASATEARYNKLKEKHSELVHVHAELLRKNADTAKQLTVTQQSQEEVARVKE    421 - 490
QLAFQVEQVKRESELKLEEKSDQLEKLKRELEAKAGELARAQEALSHTEQSKSELSSRLDTLSAEKDALS    491 - 560
GAVRQREADLLAAQSLVRETEAALSREQQRSSQEQGELQGRLAERESQEQGLRQRLLDEQFAVLRGAAAE    561 - 630
AAGILQDAVSKLDDPLHLRCTSSPDYLVSRAQEALDAVSTLEEGHAQYLTSLADASALVAALTRFSHLAA    631 - 700
DTIINGGATSHLAPTDPADRLIDTCRECGARALELMGQLQDQQALRHMQASLVRTPLQGILQLGQELKPK    701 - 770
SLDVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVNERILNSCTDLMKAIRLLVTT    771 - 840
STSLQKEIVESGRGAATQQEFYAKNSRWTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEI    841 - 910
AASTAQLVAASKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTMDFSGLSLIKLKKQE    911 - 980
METQVRVLELEKTLEAERMRLGELRKQHYVLAGASGSPGEEVAIRPSTAPRSVTTKKPPLAQKPSVAPRQ    981 - 1050
DHQLDKKDGIYPAQLVNY                                                       1051 - 1068
//

Text Mined References (36)

PMID Year Title