Property Summary

NCBI Gene PubMed Count 60
Grant Count 87
R01 Count 73
Funding $5,045,869.65
PubMed Score 143.51
PubTator Score 65.46

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O75144 A8MUZ1 Q9HD18 Q9NRQ1
Symbols B7H2
GL50
B7-H2
B7RP1
CD275
ICOSL
LICOS
B7RP-1
ICOS-L

Gene

Gene RIF (39)

PMID Text
26560438 The ICOS and ICOSL SNPs examined do not have an apparent effect on the disease susceptibility and prognosis of autoimmune thyroid diseases.
25769613 ICOS-ICOS-L interaction promoted cytokine production and survival in type 2 innate lymphoid cells through STAT5 signaling in asthma.
25406581 Loss-of-function mutations in NIK cause impaired ICOSL expression.
24837102 a critical role is described for the rs7282490 ICOSLG region polymorphism associated with immune-mediated diseases in amplifying pattern-recognition receptor initiated inflammatory signaling and cytokine secretion
24729612 the B7h-ICOS interaction may modulate the spread of cancer metastases
24661627 Our data show that mDCs from patients with AR display impaired expression of ICOSL, and this defect licenses mDCs to promote aberrant IL-13- and IL-5-producing Th2 cell responses.
23688438 Findings suggest that the single nucleotide polymorphism (snp) rs4819388 in B7-H2 3'-UTR, through disrupting the regulatory role of miR-24 on B7-H2 expression, contributes to the occurrence of gastric cancer.
23196741 These data suggest that rs2294020 SNP of FOXP3 gene and rs378299 SNP of ICOSLG gene are associated with alopecia areata and with a reduced expression of the FOXP3 and ICOSLG genes in alopecia patients.
23026134 Results highlight an important relationship between Treg and pDC in breast tumors, and show that ICOS/ICOS-L interaction is a central event in immunosuppression of tumor-associated memory CD4(+) T cells.
23024058 ICOSL-expressing macrophages and mRNA levels of ICOSL were increased in the lesional skin of patients with early diffuse cutaneous systemic sclerosis.
More...

AA Sequence

MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQN      1 - 70
SSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSV     71 - 140
PVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPS    141 - 210
VNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDR    211 - 280
CLQHSYAGAWAVSPETELTGHV                                                    281 - 302
//

Text Mined References (61)

PMID Year Title
26560438 2016 Association of polymorphisms in the ICOS and ICOSL genes with the pathogenesis of autoimmune thyroid diseases.
25769613 2015 ICOS:ICOS-ligand interaction is required for type 2 innate lymphoid cell function, homeostasis, and induction of airway hyperreactivity.
25406581 2014 Biallelic loss-of-function mutation in NIK causes a primary immunodeficiency with multifaceted aberrant lymphoid immunity.
24837102 2014 Pattern recognition receptor signaling in human dendritic cells is enhanced by ICOS ligand and modulated by the Crohn's disease ICOSLG risk allele.
24729612 2014 B7h triggering inhibits the migration of tumor cell lines.
24661627 2014 Impaired ICOSL in human myeloid dendritic cells promotes Th2 responses in patients with allergic rhinitis and asthma.
23688438 2013 A functional variant at miR-24 binding site in B7-H2 alters susceptibility to gastric cancer in a Chinese Han population.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23196741 2014 Single nucleotide polymorphisms in the promoter regions of Foxp3 and ICOSLG genes are associated with Alopecia areata.
More...