Property Summary

NCBI Gene PubMed Count 62
PubMed Score 153.20
PubTator Score 65.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

 GO Function (1)

Protein-protein Interaction (6)

Gene RIF (41)

AA Sequence

MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQN      1 - 70
SSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSV     71 - 140
PVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPS    141 - 210
VNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDR    211 - 280
CLQHSYAGAWAVSPETELTGHV                                                    281 - 302
//

Text Mined References (64)

PMID Year Title