Property Summary

NCBI Gene PubMed Count 30
Grant Count 1
Funding $8,020
PubMed Score 27.77
PubTator Score 31.21

Knowledge Summary

Patent

No data available

Expression

Gene

PANTHER Protein Class (1)

 Grant Application (1)

Gene RIF (18)

PMID Text
26517016 DEPDC5 variants increase fibrosis progression in European subjects with chronic HCV infection. Our findings suggest that DEPDC5 down-regulation may contribute to HCV-related fibrosis by increasing MMP2 synthesis through the beta-catenin pathway
26216793 This study found a single DEPDC5 mutation in one of (2.2%) 45 families with genetic temporal lobe epilepsy, a proportion much lower than that reported in other inherited focal epilepsies.
25964426 This revealed four patients to have two or more tumors that were clonally related, all of which lacked MED12 mutations. DEPDC5 was discovered as a novel tumor suppressor gene playing a role in the progression of uterine leiomyomas.
25764692 MICA and DEPDC5 SNPs were found to be strongly associated with HCV-induced HCC.
25623524 Truncating DEPDC5 mutations were found in all four French families with focal cortical dysplasia and focal epilepsy.
25599672 An association was made for DEPDC5 with sporadic focal cortical dysplasia and also hemimegalencephaly.
25551790 Genetic variations in DEPDC5 gene region may influence HCV-associated liver cirrhosis and/or hepatocellular carcinoma. development.
25366275 The effects of 10 DEPDC5 variants identified in individuals with focal epilepsy and two DEPDC5 variants identified in serous ovarian tumors, on TORC1 signaling and GATOR-1 complex formation.
25194487 This chapter focuses on DEPDC5, a newly identified gene in autosomal dominant focal epilepsies [review]
25032264 PAPL, IL10RB and DEPDC5 polymorphisms have an impact on progression of hepatitis B virus-related liver disease.
More...

AA Sequence

MRTTKVYKLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEIAHPNDEYSPLLLQVKSLKEDLQKETISVD      1 - 70
QTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAGIRAQ     71 - 140
AGELWVKNEKVMCGYISEDTRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEK    141 - 210
NCSHEVTVVLFSRTFYDAKSVDEFPEINRASIRQDHKGRFYEDFYKVVVQNERREEWTSLLVTIKKLFIQ    211 - 280
YPVLVRLEQAEGFPQGDNSTSAQGNYLEAINLSFNVFDKHYINRNFDRTGQMSVVITPGVGVFEVDRLLM    281 - 350
ILTKQRMIDNGIGVDLVCMGEQPLHAVPLFKLHNRSAPRDSRLGDDYNIPHWINHSFYTSKSQLFCNSFT    351 - 420
PRIKLAGKKPASEKAKNGRDTSLGSPKESENALPIQVDYDAYDAQVFRLPGPSRAQCLTTCRSVRERESH    421 - 490
SRKSASSCDVSSSPSLPSRTLPTEEVRSQASDDSSLGKSANILMIPHPHLHQYEVSSSLGYTSTRDVLEN    491 - 560
MMEPPQRDSSAPGRFHVGSAESMLHVRPGGYTPQRALINPFAPSRMPMKLTSNRRRWMHTFPVGPSGEAI    561 - 630
QIHHQTRQNMAELQGSGQRDPTHSSAELLELAYHEAAGRHSNSRQPGDGMSFLNFSGTEELSVGLLSNSG    631 - 700
AGMNPRTQNKDSLEDSVSTSPDPILTLSAPPVVPGFCCTVGVDWKSLTTPACLPLTTDYFPDRQGLQNDY    701 - 770
TEGCYDLLPEADIDRRDEDGVQMTAQQVFEEFICQRLMQGYQIIVQPKTQKPNPAVPPPLSSSPLYSRGL    771 - 840
VSRNRPEEEDQYWLSMGRTFHKVTLKDKMITVTRYLPKYPYESAQIHYTYSLCPSHSDSEFVSCWVEFSH    841 - 910
ERLEEYKWNYLDQYICSAGSEDFSLIESLKFWRTRFLLLPACVTATKRITEGEAHCDIYGDRPRADEDEW    911 - 980
QLLDGFVRFVEGLNRIRRRHRSDRMMRKGTAMKGLQMTGPISTHSLESTAPPVGKKGTSALSALLEMEAS    981 - 1050
QKCLGEQQAAVHGGKSSAQSAESSSVAMTPTYMDSPRKDGAFFMEFVRSPRTASSAFYPQVSVDQTATPM   1051 - 1120
LDGTSLGICTGQSMDRGNSQTFGNSQNIGEQGYSSTNSSDSSSQQLVASSLTSSSTLTEILEAMKHPSTG   1121 - 1190
VQLLSEQKGLSPYCFISAEVVHWLVNHVEGIQTQAMAIDIMQKMLEEQLITHASGEAWRTFIYGFYFYKI   1191 - 1260
VTDKEPDRVAMQQPATTWHTAGVDDFASFQRKWFEVAFVAEELVHSEIPAFLLPWLPSRPASYASRHSSF   1261 - 1330
SRSFGGRSQAAALLAATVPEQRTVTLDVDVNNRTDRLEWCSCYYHGNFSLNAAFEIKLHWMAVTAAVLFE   1331 - 1400
MVQGWHRKATSCGFLLVPVLEGPFALPSYLYGDPLRAQLFIPLNISCLLKEGSEHLFDSFEPETYWDRMH   1401 - 1470
LFQEAIAHRFGFVQDKYSASAFNFPAENKPQYIHVTGTVFLQLPYSKRKFSGQQRRRRNSTSSTNQNMFC   1471 - 1540
EERVGYNWAYNTMLTKTWRSSATGDEKFADRLLKDFTDFCINRDNRLVTFWTSCLEKMHASAP          1541 - 1603
//

Text Mined References (33)

PMID Year Title
26517016 2016 DEPDC5 variants increase fibrosis progression in Europeans with chronic hepatitis C virus infection.
26216793 2015 DEPDC5 mutations are not a frequent cause of familial temporal lobe epilepsy.
25964426 2015 Clonally related uterine leiomyomas are common and display branched tumor evolution.
25764692 2015 [Hepatitis C virus induced hepatocellular carcinoma associated genes].
25623524 2015 Familial focal epilepsy with focal cortical dysplasia due to DEPDC5 mutations.
25599672 2015 Mammalian target of rapamycin pathway mutations cause hemimegalencephaly and focal cortical dysplasia.
25551790 2014 Variations in DEPDC5 gene and its association with chronic hepatitis C virus infection in Saudi Arabia.
25457612 2014 Sestrins inhibit mTORC1 kinase activation through the GATOR complex.
25366275 2015 Preliminary functional assessment and classification of DEPDC5 variants associated with focal epilepsy.
25194487 2014 Genetics advances in autosomal dominant focal epilepsies: focus on DEPDC5.
More...