Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.10
PubTator Score 5.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 1.3e-04
ependymoma 1.100 2.5e-06
glioblastoma 1.300 1.4e-07
group 3 medulloblastoma 2.300 6.1e-06
lung cancer 1.800 1.3e-02
medulloblastoma, large-cell 2.600 1.1e-07
osteosarcoma -1.062 1.3e-03
pediatric high grade glioma 1.300 3.0e-06
primitive neuroectodermal tumor 2.400 7.6e-08
subependymal giant cell astrocytoma -1.225 1.6e-02

Gene RIF (3)

AA Sequence

MENNLKTCPKEDGDFVSDKIKFKIEEEDDDGIPPDSLERMDFKSEQEDMKQTDSGGERAGLGGTGCSCKP      1 - 70
PGKYLSAESEDDYGALFSQYSSTLYDVAMEAVTQSLLSSRNMSSRKKSPAWKHFFISPRDSTKAICMYCV     71 - 140
KEFSRGKNEKDLSTSCLMRHVRRAHPTVLIQENGSVSAVSSFPSPSLLLPPQPADAGDLSTILSPIKLVQ    141 - 210
KVASKIPSPDRITEESVSVVSSEEISSDMSVSEKCGREEALVGSSPHLPALHYDEPAENLAEKSLPLPKS    211 - 280
TSGSRRRSAVWKHFYLSPLDNSKAVCIHCMNEFSRGKNGKDLGTSCLIRHMWRAHRAIVLQENGGTGIPP    281 - 350
LYSTPPTLLPSLLPPEGELSSVSSSPVKPVRESPSASSSPDRLTEDLQSHLNPGDGLMEDVAAFSSSDDI    351 - 420
GEASASSPEKQQADGLSPRLFESGAIFQQNKKVMKRLKSEVWHHFSLAPMDSLKAECRYCGCAISRGKKG    421 - 490
DVGTSCLMRHLYRRHPEVVGSQKGFLGASLANSPYATLASAESSSSKLTDLPTVVTKNNQVMFPVNSKKT    491 - 560
SKLWNHFSICSADSTKVVCLHCGRTISRGKKPTNLGTSCLLRHLQRFHSNVLKTEVSETARPSSPDTRVP    561 - 630
RGTELSGASSFDDTNEKFYDSHPVAKKITSLIAEMIALDLQPYSFVDNVGFNRLLEYLKPQYSLPAPSYF    631 - 700
SRTAIPGMYDNVKQIIMSHLKEAESGVIHFTSGIWMSNQTREYLTLTAHWVSFESPARPRCDDHHCSALL    701 - 770
DVSQVDCDYSGNSIQKQLECWWEAWVTSTGLQVGITVTDNASIGKTLNEGEHSSVQCFSHTVNLIVSEAI    771 - 840
KSQRMVQNLLSLARKICERVHRSPKAKEKLAELQREYALPQHHLIQDVPSKWSTSFHMLERLIEQKRAIN    841 - 910
EMSVECNFRELISCDQWEVMQSVCRALKPFEAASREMSTQMSTLSQVIPMVHILNRKVEMLFEETMGIDT    911 - 980
MLRSLKEAMVSRLSATLHDPRYVFATLLDPRYKASLFTEEEAEQYKQDLIRELELMNSTSEDVAASHRCD    981 - 1050
AGSPSKDSAAEENLWSLVAKVKKKDPREKLPEAMVLAYLEEEVLEHSCDPLTYWNLKKASWPGLSALAVR   1051 - 1120
FLGCPPSIVPSEKLFNTPTENGSLGQSRLMMEHFEKLIFLKVNLPLIYFQY                      1121 - 1171
//

Text Mined References (15)

PMID Year Title