Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.10
PubTator Score 5.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 3.79799119816176E-9
primitive neuroectodermal tumor 3031 7.61872239225315E-8
medulloblastoma, large-cell 6234 1.10202324569889E-7
glioblastoma 5572 1.37832828514279E-7
ependymoma 2514 2.49881205749003E-6
pediatric high grade glioma 2712 3.01991986911603E-6
atypical teratoid / rhabdoid tumor 4369 1.27562675884801E-4
osteosarcoma 7933 0.0012527412920868
lung cancer 4473 0.0133525897588007
subependymal giant cell astrocytoma 2287 0.0156520359639992

Expression

  Differential Expression (10)

Synonym

Accession O75132 B2RZH1 Q1ECU0 Q9UGG8
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Pathway (1)

Gene RIF (3)

PMID Text
20238005 ZBED4, a novel protein that in human retina is localized to cone photoreceptors and glial Muller cells.
19693800 Observational study of gene-disease association. (HuGE Navigator)
19369242 ZBED4 cellular/subcellular localization and domains suggest a regulatory role for this protein, which may exert its effects in cones and Muller cells through multiple ways of action.

AA Sequence

MENNLKTCPKEDGDFVSDKIKFKIEEEDDDGIPPDSLERMDFKSEQEDMKQTDSGGERAGLGGTGCSCKP      1 - 70
PGKYLSAESEDDYGALFSQYSSTLYDVAMEAVTQSLLSSRNMSSRKKSPAWKHFFISPRDSTKAICMYCV     71 - 140
KEFSRGKNEKDLSTSCLMRHVRRAHPTVLIQENGSVSAVSSFPSPSLLLPPQPADAGDLSTILSPIKLVQ    141 - 210
KVASKIPSPDRITEESVSVVSSEEISSDMSVSEKCGREEALVGSSPHLPALHYDEPAENLAEKSLPLPKS    211 - 280
TSGSRRRSAVWKHFYLSPLDNSKAVCIHCMNEFSRGKNGKDLGTSCLIRHMWRAHRAIVLQENGGTGIPP    281 - 350
LYSTPPTLLPSLLPPEGELSSVSSSPVKPVRESPSASSSPDRLTEDLQSHLNPGDGLMEDVAAFSSSDDI    351 - 420
GEASASSPEKQQADGLSPRLFESGAIFQQNKKVMKRLKSEVWHHFSLAPMDSLKAECRYCGCAISRGKKG    421 - 490
DVGTSCLMRHLYRRHPEVVGSQKGFLGASLANSPYATLASAESSSSKLTDLPTVVTKNNQVMFPVNSKKT    491 - 560
SKLWNHFSICSADSTKVVCLHCGRTISRGKKPTNLGTSCLLRHLQRFHSNVLKTEVSETARPSSPDTRVP    561 - 630
RGTELSGASSFDDTNEKFYDSHPVAKKITSLIAEMIALDLQPYSFVDNVGFNRLLEYLKPQYSLPAPSYF    631 - 700
SRTAIPGMYDNVKQIIMSHLKEAESGVIHFTSGIWMSNQTREYLTLTAHWVSFESPARPRCDDHHCSALL    701 - 770
DVSQVDCDYSGNSIQKQLECWWEAWVTSTGLQVGITVTDNASIGKTLNEGEHSSVQCFSHTVNLIVSEAI    771 - 840
KSQRMVQNLLSLARKICERVHRSPKAKEKLAELQREYALPQHHLIQDVPSKWSTSFHMLERLIEQKRAIN    841 - 910
EMSVECNFRELISCDQWEVMQSVCRALKPFEAASREMSTQMSTLSQVIPMVHILNRKVEMLFEETMGIDT    911 - 980
MLRSLKEAMVSRLSATLHDPRYVFATLLDPRYKASLFTEEEAEQYKQDLIRELELMNSTSEDVAASHRCD    981 - 1050
AGSPSKDSAAEENLWSLVAKVKKKDPREKLPEAMVLAYLEEEVLEHSCDPLTYWNLKKASWPGLSALAVR   1051 - 1120
FLGCPPSIVPSEKLFNTPTENGSLGQSRLMMEHFEKLIFLKVNLPLIYFQY                      1121 - 1171
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23533661 2013 ZBED evolution: repeated utilization of DNA transposons as regulators of diverse host functions.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20238005 2010 ZBED4, a novel retinal protein expressed in cones and Müller cells.
19693800 2010 Support of association between BRD1 and both schizophrenia and bipolar affective disorder.
19369242 2009 ZBED4, a BED-type zinc-finger protein in the cones of the human retina.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17209048 2007 Human DNA replication-related element binding factor (hDREF) self-association via hATC domain is necessary for its nuclear accumulation and DNA binding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...