Property Summary

NCBI Gene PubMed Count 25
PubMed Score 9.49
PubTator Score 8.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma 2.000 2.1e-02
atypical teratoid / rhabdoid tumor -1.800 2.5e-03
ependymoma 1.200 2.5e-02
group 4 medulloblastoma 1.900 1.4e-05
interstitial cystitis -1.100 6.3e-03
lung cancer 2.300 6.2e-05
lung carcinoma 1.600 3.7e-13
Multiple Sclerosis -1.400 2.0e-03
non primary Sjogren syndrome sicca -1.500 2.1e-02
oligodendroglioma 1.200 2.3e-02
permanent atrial fibrillation -1.100 1.1e-05
pituitary cancer 3.200 3.1e-07
primitive neuroectodermal tumor -1.300 1.8e-02
psoriasis -1.700 2.8e-04

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (13)

AA Sequence

MAAAGARLSPGPGSGLRGRPRLCFHPGPPPLLPLLLLFLLLLPPPPLLAGATAAASREPDSPCRLKTVTV      1 - 70
STLPALRESDIGWSGARAGAGAGTGAGAAAAAASPGSPGSAGTAAESRLLLFVRNELPGRIAVQDDLDNT     71 - 140
ELPFFTLEMSGTAADISLVHWRQQWLENGTLYFHVSMSSSGQLAQATAPTLQEPSEIVEEQMHILHISVM    141 - 210
GGLIALLLLLLVFTVALYAQRRWQKRRRIPQKSASTEATHEIHYIPSVLLGPQARESFRSSRLQTHNSVI    211 - 280
GVPIRETPILDDYDCEEDEEPPRRANHVSREDEFGSQVTHTLDSLGHPGEEKVDFEKKAAAEATQETVES    281 - 350
LMQKFKESFRANTPIEIGQLQPPLRSTSAGKRKRRSKSRGGISFGRAKGTSGSEADDETQLTFYTEQYRS    351 - 420
RRRSKGLLKSPVNKTALTLIAVSSCILAMVCGSQMSCPLTVKVTLHVPEHFIADGSSFVVSEGSYLDISD    421 - 490
WLNPAKLSLYYQINATSPWVRDLCGQRTTDACEQLCDPETGECSCHEGYAPDPVHRHLCVRSDWGQSEGP    491 - 560
WPYTTLERGYDLVTGEQAPEKILRSTFSLGQGLWLPVSKSFVVPPVELSINPLASCKTDVLVTEDPADVR    561 - 630
EEAMLSTYFETINDLLSSFGPVRDCSRNNGGCTRNFKCVSDRQVDSSGCVCPEELKPMKDGSGCYDHSKG    631 - 700
IDCSDGFNGGCEQLCLQQTLPLPYDATSSTIFMFCGCVEEYKLAPDGKSCLMLSDVCEGPKCLKPDSKFN    701 - 770
DTLFGEMLHGYNNRTQHVNQGQVFQMTFRENNFIKDFPQLADGLLVIPLPVEEQCRGVLSEPLPDLQLLT    771 - 840
GDIRYDEAMGYPMVQQWRVRSNLYRVKLSTITLAAGFTNVLKILTKESSREELLSFIQHYGSHYIAEALY    841 - 910
GSELTCIIHFPSKKVQQQLWLQYQKETTELGSKKELKSMPFITYLSGLLTAQMLSDDQLISGVEIRCEEK    911 - 980
GRCPSTCHLCRRPGKEQLSPTPVLLEINRVVPLYTLIQDNGTKEAFKSALMSSYWCSGKGDVIDDWCRCD    981 - 1050
LSAFDANGLPNCSPLLQPVLRLSPTVEPSSTVVSLEWVDVQPAIGTKVSDYILQHKKVDEYTDTDLYTGE   1051 - 1120
FLSFADDLLSGLGTSCVAAGRSHGEVPEVSIYSVIFKCLEPDGLYKFTLYAVDTRGRHSELSTVTLRTAC   1121 - 1190
PLVDDNKAEEIADKIYNLYNGYTSGKEQQMAYNTLMEVSASMLFRVQHHYNSHYEKFGDFVWRSEDELGP   1191 - 1260
RKAHLILRRLERVSSHCSSLLRSAYIQSRVETVPYLFCRSEEVRPAGMVWYSILKDTKITCEEKMVSMAR   1261 - 1330
NTYGESKGR                                                                1331 - 1339
//

Text Mined References (29)

PMID Year Title