Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 4.8e-06
hepatocellular carcinoma 547 3.1e-05
gastric cancer 459 1.1e-03
lung cancer 4740 3.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
gastric cancer 1.600 1.1e-03
hepatocellular carcinoma 1.500 3.1e-05
lung cancer 1.200 3.5e-03
malignant mesothelioma 1.200 4.8e-06

AA Sequence

MILLSFVSDSNVGTGEKKVTEAWISEDENSHRTTSDRLTVMELPSPESEEVHEPRLGELLGNPEGQSLGS      1 - 70
SPSQDRGCKQVTVTHWKIQTGETAQVCTKSGRNHILNSDLLLLQRELIEGEANPCNICGKTFTFNSDLVR     71 - 140
HRISHAGEKPYTCDQCGKGFGQSSHLMEHQRIHTGERLYVCNVCGKDFIHYSGLIEHQRVHSGEKPFKCA    141 - 210
QCGKAFCHSSDLIRHQRVHTRERPFECKECGKGFSQSSLLIRHQRIHTGERPYECNECGKSFIRSSSLIR    211 - 280
HYQIHTEVKQYECKECGKAFRHRSDLIEHQRIHTGERPFECNECGKAFIRSSKLIQHQRIHTGERPYVCN    281 - 350
ECGKRFSQTSNFTQHQRIHTGEKLYECNECGKAFFLSSYLIRHQKIHTGERVYECKECGKAFLQKAHLTE    351 - 420
HQKIHSGDRPFECKDCGKAFIQSSKLLLHQIIHTGEKPYVCSYCGKGFIQRSNFLQHQKIHTEEKLYECS    421 - 490
QYGRDFNSTTNVKNNQRVHQEGLSLSKAPIHLGERSVDKGEHTGNL                            491 - 536
//

Text Mined References (7)

PMID Year Title