Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.60
PubTator Score 2.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.000 1.9e-03
Breast cancer -1.700 1.9e-04
Down syndrome 1.100 4.6e-03
gastric cancer 1.600 9.0e-03
group 3 medulloblastoma -3.900 1.2e-07
hepatocellular carcinoma 1.400 3.3e-03
interstitial cystitis -3.600 2.6e-04
lung adenocarcinoma -1.100 2.8e-14
lung cancer -1.200 9.7e-03
malignant mesothelioma 1.800 1.2e-06
medulloblastoma, large-cell -4.100 5.1e-06
non-small cell lung cancer -1.481 5.1e-11
osteosarcoma -2.051 8.8e-05
ovarian cancer -1.900 2.1e-05
pancreatic cancer 1.900 3.7e-03
pancreatic carcinoma 1.900 3.7e-03
pancreatic ductal adenocarcinoma liver m... -2.033 1.0e-02
pituitary cancer -3.000 3.9e-05
primitive neuroectodermal tumor -2.900 2.4e-03
psoriasis -2.100 5.8e-05
Waldenstrons macroglobulinemia -1.039 2.6e-02

Gene RIF (1)

AA Sequence

MDRLKSHLTVCFLPSVPFLILVSTLATAKSVTNSTLNGTNVVLGSVPVIIARTDHIIVKEGNSALINCSV      1 - 70
YGIPDPQFKWYNSIGKLLKEEEDEKERGGGKWQMHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTL     71 - 140
RVIFTSGDMGVYYMVVCLVAFTIVMVLNITRLCMMSSHLKKTEKAINEFFRTEGAEKLQKAFEIAKRIPI    141 - 210
ITSAKTLELAKVTQFKTMEFARYIEELARSVPLPPLIMNCRTIMEEIMEVVGLEEQGQNFVRHTPEGQEA    211 - 280
ADRDEVYTIPNSLKRSDSPAADSDASSLHEQPQQIAIKVSVHPQSKKEHADDQEGGQFEVKDVEETELSA    281 - 350
EHSPETAEPSTDVTSTELTSEEPTPVEVPDKVLPPAYLEATEPAVTHDKNTCIIYESHV               351 - 409
//

Text Mined References (7)

PMID Year Title