Property Summary

Ligand Count 598
NCBI Gene PubMed Count 152
PubMed Score 283.03
PubTator Score 179.14

Knowledge Summary

Patent (15,745)

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.100 1.6e-02
atypical teratoid / rhabdoid tumor -1.500 2.4e-05
ependymoma -1.500 1.0e-02
esophageal adenocarcinoma 1.100 3.2e-02
hereditary spastic paraplegia -1.099 1.7e-02
lung cancer 1.300 3.2e-02
medulloblastoma -1.300 2.0e-03
medulloblastoma, large-cell -1.600 1.7e-05
oligodendroglioma -1.600 4.2e-02
osteosarcoma 2.741 1.2e-08
ovarian cancer -1.300 1.5e-04

Protein-protein Interaction (4)

Gene RIF (133)

AA Sequence

MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDN      1 - 70
FLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEE     71 - 140
RDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGL    141 - 210
IHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSV    211 - 280
GVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQ    281 - 350
HPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL    351 - 420
LLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKTAKELEEEITL    421 - 490
RKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQLEDLKKRNQNSQISTEKVNQL    491 - 560
QRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNRDLQDKNCLLETAKLKLEKEFINLQSALESE    561 - 630
RRDRTHGSEIINDLQGRICGLEEDLKNGKILLAKVELEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQS    631 - 700
LEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQ    701 - 770
SQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMN    771 - 840
LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQKKQELQDERDS    841 - 910
LAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQELTEKDATIASLEETNRTLTS    911 - 980
DVANLANEKEELNNKLKDVQEQLSRLKDEEISAAAIKAQFEKQLLTERTLKTQAVNKLAEIMNRKEPVKR    981 - 1050
GNDTDVRRKEKENRKLHMELKSEREKLTQQMIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLR   1051 - 1120
SQLQALHIGLDSSSIGSGPGDAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQD   1121 - 1190
KEQSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKG   1191 - 1260
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLL   1261 - 1330
ANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS               1331 - 1388
//

Text Mined References (165)

PMID Year Title