Property Summary

NCBI Gene PubMed Count 129
Grant Count 80
R01 Count 53
Funding $6,148,525.98
PubMed Score 248.30
PubTator Score 179.14

Knowledge Summary

Patent (15,745)

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.100 0.016
ependymoma -1.500 0.010
oligodendroglioma -1.600 0.042
esophageal adenocarcinoma 1.100 0.032
osteosarcoma 2.741 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma -1.300 0.002
medulloblastoma, large-cell -1.600 0.000
hereditary spastic paraplegia -1.099 0.017
lung cancer 1.300 0.032
ovarian cancer -1.300 0.000

Synonym

Accession O75116 Q53QZ0 Q53SJ7 Q9UQN5
Symbols ROCK-II

Gene

PDB

4L6Q   4WOT  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
604 screening 212 / 0 / 59593 Primary biochemical high-throughput screening assay for inhibitors of Rho kinase 2 (Rhok2)
644 confirmatory 67 / 0 / 139 Dose-response biochemical assay of inhibitors of Rho kinase 2 (Rock2)
791 confirmatory 21 / 0 / 2 Dose-response biochemical assay of Rho kinase 2 (Rock2) inhibitors
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (112)

PMID Text
26928204 Uniaxial stretch activates JNK1 via RhoA and ROCK pathways in human bladder smooth muscle cells.
26901778 Rho Kinase ROCK2 Mediates Acid-Induced NADPH Oxidase NOX5-S Expression in Human Esophageal Adenocarcinoma Cells
26826790 ROCK1 and ROCK2 differentially regulate invadopodia activity through separate signaling pathways.
26818518 This study report that protein levels of the Rho-associated protein kinases (ROCK2) was increased in Progressive Supranuclear Palsy and Corticobasal Degeneration brains.
26818475 Data clearly suggests association of ROCK2 polymorphisms and haplotypes with high altitude essential hypertension in a Ladakhi Indian population.
26626121 Study shows that nuclear ROCKII activation signal might contribute to the tumor metastasis in breast cancer.
26620183 ROCK2 forms a dimer, 120 nm in length, with a long coiled-coil tether linking the kinase and membrane-binding domains.
26572751 no differences in renal interstitial fibrosis or UUOinduced ROCK activity were identified between the ROCK2 heterozygote knockout and WT mice, indicating that the genetic partial disruption of ROCK2 is insufficient for protecting against renal fibrosis.
26505794 beta-catenin/TCF4 pathway contributed to the effects of Rock2 in CRC cells, and Rock2 stabilized beta-catenin by preventing its ubiquitination and degradation
26481340 ROCK activity in MS serum was elevated compared with serum from healthy controls
More...

AA Sequence

MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDN      1 - 70
FLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEE     71 - 140
RDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGL    141 - 210
IHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSV    211 - 280
GVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQ    281 - 350
HPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL    351 - 420
LLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKTAKELEEEITL    421 - 490
RKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQLEDLKKRNQNSQISTEKVNQL    491 - 560
QRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNRDLQDKNCLLETAKLKLEKEFINLQSALESE    561 - 630
RRDRTHGSEIINDLQGRICGLEEDLKNGKILLAKVELEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQS    631 - 700
LEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQ    701 - 770
SQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMN    771 - 840
LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQKKQELQDERDS    841 - 910
LAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQELTEKDATIASLEETNRTLTS    911 - 980
DVANLANEKEELNNKLKDVQEQLSRLKDEEISAAAIKAQFEKQLLTERTLKTQAVNKLAEIMNRKEPVKR    981 - 1050
GNDTDVRRKEKENRKLHMELKSEREKLTQQMIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLR   1051 - 1120
SQLQALHIGLDSSSIGSGPGDAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQD   1121 - 1190
KEQSNPYMVLDIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKG   1191 - 1260
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLL   1261 - 1330
ANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS               1331 - 1388
//

Text Mined References (142)

PMID Year Title
26928204 2016 Uni-axial stretch induces actin stress fiber reorganization and activates c-Jun NH2 terminal kinase via RhoA and Rho kinase in human bladder smooth muscle cells.
26901778 2016 Rho Kinase ROCK2 Mediates Acid-Induced NADPH Oxidase NOX5-S Expression in Human Esophageal Adenocarcinoma Cells.
26826790 2016 Matrix rigidity differentially regulates invadopodia activity through ROCK1 and ROCK2.
26818518 2016 Rho Kinase Inhibition as a Therapeutic for Progressive Supranuclear Palsy and Corticobasal Degeneration.
26818475 2016 Polymorphisms and haplotype of ROCK2 associate with high altitude essential hypertension in native high altitude Ladakhi Indian population: a preliminary study.
26626121 2015 Immunohistochemical evaluation of ROCK activation in invasive breast cancer.
26620183 2015 A molecular ruler regulates cytoskeletal remodelling by the Rho kinases.
26572751 2016 Partial deletion of the ROCK2 protein fails to reduce renal fibrosis in a unilateral ureteral obstruction model in mice.
26505794 2015 Rock2 stabilizes ?-catenin to promote tumor invasion and metastasis in colorectal cancer.
26481340 2015 Role of Rho Kinase and Fasudil on Synaptic Plasticity in Multiple Sclerosis.
More...