Property Summary

NCBI Gene PubMed Count 33
PubMed Score 736.44
PubTator Score 267.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Myofibrillar Myopathy 9 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Dilated cardiomyopathy 56 0.0 5.0
Disease Target Count Z-score Confidence
Myopathy 185 4.737 2.4
Cardiomyopathy 116 4.247 2.1

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy -1.376 7.2e-08
astrocytoma -1.200 3.0e-10
Astrocytoma, Pilocytic -2.200 1.7e-05
atypical teratoid / rhabdoid tumor -1.600 1.1e-04
colon cancer -3.100 3.7e-06
ependymoma -2.700 3.0e-02
glioblastoma -1.700 9.1e-04
group 4 medulloblastoma -2.200 2.9e-03
lung cancer -2.300 3.9e-04
oligodendroglioma -1.300 1.8e-07
ovarian cancer -1.200 4.9e-02
pediatric high grade glioma -2.100 8.4e-05
Pick disease -1.300 3.2e-02
primitive neuroectodermal tumor -1.400 6.7e-03
psoriasis -1.100 3.3e-04
subependymal giant cell astrocytoma -1.877 4.7e-03

Protein-protein Interaction (2)

Gene RIF (15)

AA Sequence

MSYSVTLTGPGPWGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDLVVAIDGVNTDTMTHLEAQNKIK      1 - 70
SASYNLSLTLQKSKRPIPISTTAPPVQTPLPVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRP     71 - 140
TFSPAFSRPSAFSSLAEASDPGPPRASLRAKTSPEGARDLLGPKALPGSSQPRQYNNPIGLYSAETLREM    141 - 210
AQMYQMSLRGKASGVGLPGGSLPIKDLAVDSASPVYQAVIKSQNKPEDEADEWARRSSNLQSRSFRILAQ    211 - 280
MTGTEFMQDPDEEALRRSSTPIEHAPVCTSQATTPLLPASAQPPAAASPSAASPPLATAAAHTAIASAST    281 - 350
TAPASSPADSPRPQASSYSPAVAASSAPATHTSYSEGPAAPAPKPRVVTTASIRPSVYQPVPASTYSPSP    351 - 420
GANYSPTPYTPSPAPAYTPSPAPAYTPSPVPTYTPSPAPAYTPSPAPNYNPAPSVAYSGGPAEPASRPPW    421 - 490
VTDDSFSQKFAPGKSTTSISKQTLPRGGPAYTPAGPQVPPLARGTVQRAERFPASSRTPLCGHCNNVIRG    491 - 560
PFLVAMGRSWHPEEFTCAYCKTSLADVCFVEEQNNVYCERCYEQFFAPLCAKCNTKIMGEVMHALRQTWH    561 - 630
TTCFVCAACKKPFGNSLFHMEDGEPYCEKDYINLFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFICAVC    631 - 700
HVNLEGQPFYSKKDRPLCKKHAHTINL                                               701 - 727
//

Text Mined References (35)

PMID Year Title