Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.28
PubTator Score 1.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -1.400 1.2e-05
atypical teratoid / rhabdoid tumor -1.100 4.1e-04
autosomal dominant Emery-Dreifuss muscul... 1.208 9.0e-04
Becker muscular dystrophy 1.277 1.3e-04
chronic kidney disease 1.100 1.4e-02
chronic rhinosinusitis -1.033 6.5e-03
cystic fibrosis -1.100 1.6e-03
dermatomyositis 1.700 2.9e-03
Duchenne muscular dystrophy 1.309 6.4e-09
ependymoma -1.400 4.2e-08
glioblastoma -1.100 1.1e-05
interstitial cystitis -1.400 1.1e-03
intraductal papillary-mucinous carcinoma... 1.200 2.2e-02
intraductal papillary-mucinous neoplasm ... 1.400 1.5e-02
juvenile dermatomyositis 1.610 9.1e-10
limb girdle muscular dystrophy 2A 1.129 2.0e-06
lung cancer 1.500 1.8e-02
lung carcinoma 1.600 3.7e-25
malignant mesothelioma -3.900 1.3e-08
medulloblastoma, large-cell -1.900 9.1e-04
osteosarcoma -1.297 4.1e-03
ovarian cancer -1.700 3.3e-05
subependymal giant cell astrocytoma -1.686 9.1e-03

Gene RIF (3)

AA Sequence

MTDNIPLQPVRQKKRMDSRPRAGCCEWLRCCGGGEARPRTVWLGHPEKRDQRYPRNVINNQKYNFFTFLP      1 - 70
GVLFNQFKYFFNLYFLLLACSQFVPEMRLGALYTYWVPLGFVLAVTVIREAVEEIRCYVRDKEVNSQVYS     71 - 140
RLTARGTVKVKSSNIQVGDLIIVEKNQRVPADMIFLRTSEKNGSCFLRTDQLDGETDWKLRLPVACTQRL    141 - 210
PTAADLLQIRSYVYAEEPNIDIHNFVGTFTREDSDPPISESLSIENTLWAGTVVASGTVVGVVLYTGREL    211 - 280
RSVMNTSNPRSKIGLFDLEVNCLTKILFGALVVVSLVMVALQHFAGRWYLQIIRFLLLFSNIIPISLRVN    281 - 350
LDMGKIVYSWVIRRDSKIPGTVVRSSTIPEQLGRISYLLTDKTGTLTQNEMIFKRLHLGTVAYGLDSMDE    351 - 420
VQSHIFSIYTQQSQDPPAQKGPTLTTKVRRTMSSRVHEAVKAIALCHNVTPVYESNGVTDQAEAEKQYED    421 - 490
SCRVYQASSPDEVALVQWTESVGLTLVGRDQSSMQLRTPGDQILNFTILQIFPFTYESKRMGIIVRDEST    491 - 560
GEITFYMKGADVVMAGIVQYNDWLEEECGNMAREGLRVLVVAKKSLAEEQYQDFEARYVQAKLSVHDRSL    561 - 630
KVATVIESLEMEMELLCLTGVEDQLQADVRPTLETLRNAGIKVWMLTGDKLETATCTAKNAHLVTRNQDI    631 - 700
HVFRLVTNRGEAHLELNAFRRKHDCALVISGDSLEVCLKYYEYEFMELACQCPAVVCCRCAPTQKAQIVR    701 - 770
LLQERTGKLTCAVGDGGNDVSMIQESDCGVGVEGKEGKQASLAADFSITQFKHLGRLLMVHGRNSYKRSA    771 - 840
ALSQFVIHRSLCISTMQAVFSSVFYFASVPLYQGFLIIGYSTIYTMFPVFSLVLDKDVKSEVAMLYPELY    841 - 910
KDLLKGRPLSYKTFLIWVLISIYQGSTIMYGALLLFESEFVHIVAISFTSLILTELLMVALTIQTWHWLM    911 - 980
TVAELLSLACYIASLVFLHEFIDVYFIATLSFLWKVSVITLVSCLPLYVLKYLRRRFSPPSYSKLTS       981 - 1047
//

Text Mined References (11)

PMID Year Title