Property Summary

NCBI Gene PubMed Count 8
Grant Count 8
R01 Count 8
Funding $804,102.94
PubMed Score 179.26
PubTator Score 144.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ductal carcinoma in situ -1.300 0.002
invasive ductal carcinoma -1.400 0.008

Gene RIF (1)

PMID Text
19588076 AOC2 mRNA is expressed in many tissues, however, the only tissues with detectable AOC2-like enzyme activity is found in the eye.

AA Sequence

MHLKIVLAFLALSLITIFALAYVLLTSPGGSSQPPHCPSVSHRAQPWPHPGQSQLFADLSREELTAVMRF      1 - 70
LTQRLGPGLVDAAQAQPSDNCIFSVELQLPPKAAALAHLDRGSPPPAREALAIVLFGGQPQPNVSELVVG     71 - 140
PLPHPSYMRDVTVERHGGPLPYHRRPVLRAEFTQMWRHLKEVELPKAPIFLSSTFNYNGSTLAAVHATPR    141 - 210
GLRSGDRATWMALYHNISGVGLFLHPVGLELLLDHRALDPAHWTVQQVFYLGHYYADLGQLEREFKSGRL    211 - 280
EVVRVPLPPPNGASSLRSRNSPGPLPPLQFSPQGSQYSVQGNLVVSSLWSFTFGHGVFSGLRIFDVRFQG    281 - 350
ERIAYEVSVQECVSIYGADSPKTMLTRYLDSSFGLGRNSRGLVRGVDCPYQATMVDIHILVGKGAVQLLP    351 - 420
GAVCVFEEAQGLPLRRHHNYLQNHFYGGLASSALVVRSVSSVGNYDYIWDFVLYPNGALEGRVHATGYIN    421 - 490
TAFLKGGEEGLLFGNRVGERVLGTVHTHAFHFKLDLDVAGLKNWVVAEDVVFKPVAAPWNPEHWLQRPQL    491 - 560
TRQVLGKEDLTAFSLGSPLPRYLYLASNQTNAWGHQRGYRIQIHSPLGIHIPLESDMERALSWGRYQLVV    561 - 630
TQRKEEESQSSSIYHQNDIWTPTVTFADFINNETLLGEDLVAWVTASFLHIPHAEDIPNTVTLGNRVGFL    631 - 700
LRPYNFFDEDPSIFSPGSVYFEKGQDAGLCSINPVACLPDLAACVPDLPPFSYHGF                  701 - 756
//

Text Mined References (12)

PMID Year Title
20013028 2010 Structural organization of mammalian copper-containing amine oxidase genes.
19588076 2009 The unique substrate specificity of human AOC2, a semicarbazide-sensitive amine oxidase.
17400359 2007 Adipogenesis-related increase of semicarbazide-sensitive amine oxidase and monoamine oxidase in human adipocytes.
17286855 2007 Mapping of transcription start sites of human retina expressed genes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14585497 2003 Characterization of AOC2 gene encoding a copper-binding amine oxidase expressed specifically in retina.
12755418 2003 High expression of semicarbazide-sensitive amine oxidase genes AOC2 and AOC3, but not the diamine oxidase gene AOC1 in human adipocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...