Property Summary

Ligand Count 3
NCBI Gene PubMed Count 8
PubMed Score 183.26
PubTator Score 144.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ductal carcinoma in situ 1745 1.9e-03
invasive ductal carcinoma 2951 7.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Median neuropathy 3 3.92 2.0
diabetes mellitus 1728 3.82 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
ductal carcinoma in situ -1.300 1.9e-03
invasive ductal carcinoma -1.400 7.7e-03

Protein-protein Interaction (2)

Gene RIF (1)

AA Sequence

MHLKIVLAFLALSLITIFALAYVLLTSPGGSSQPPHCPSVSHRAQPWPHPGQSQLFADLSREELTAVMRF      1 - 70
LTQRLGPGLVDAAQAQPSDNCIFSVELQLPPKAAALAHLDRGSPPPAREALAIVLFGGQPQPNVSELVVG     71 - 140
PLPHPSYMRDVTVERHGGPLPYHRRPVLRAEFTQMWRHLKEVELPKAPIFLSSTFNYNGSTLAAVHATPR    141 - 210
GLRSGDRATWMALYHNISGVGLFLHPVGLELLLDHRALDPAHWTVQQVFYLGHYYADLGQLEREFKSGRL    211 - 280
EVVRVPLPPPNGASSLRSRNSPGPLPPLQFSPQGSQYSVQGNLVVSSLWSFTFGHGVFSGLRIFDVRFQG    281 - 350
ERIAYEVSVQECVSIYGADSPKTMLTRYLDSSFGLGRNSRGLVRGVDCPYQATMVDIHILVGKGAVQLLP    351 - 420
GAVCVFEEAQGLPLRRHHNYLQNHFYGGLASSALVVRSVSSVGNYDYIWDFVLYPNGALEGRVHATGYIN    421 - 490
TAFLKGGEEGLLFGNRVGERVLGTVHTHAFHFKLDLDVAGLKNWVVAEDVVFKPVAAPWNPEHWLQRPQL    491 - 560
TRQVLGKEDLTAFSLGSPLPRYLYLASNQTNAWGHQRGYRIQIHSPLGIHIPLESDMERALSWGRYQLVV    561 - 630
TQRKEEESQSSSIYHQNDIWTPTVTFADFINNETLLGEDLVAWVTASFLHIPHAEDIPNTVTLGNRVGFL    631 - 700
LRPYNFFDEDPSIFSPGSVYFEKGQDAGLCSINPVACLPDLAACVPDLPPFSYHGF                  701 - 756
//

Text Mined References (12)

PMID Year Title