Property Summary

NCBI Gene PubMed Count 39
Grant Count 20
R01 Count 17
Funding $1,498,188.8
PubMed Score 154.77
PubTator Score 31.52

Knowledge Summary

Patent

No data available

Expression

Gene RIF (24)

PMID Text
26542734 Overexpression of Slit3 induces its tumor suppressive effects in Breast cancer.
26045181 Results show that silencing of Slit3 promoted proliferation, migration and invasion of A549 cells and induced epithelial-mesenchymal transition suggesting that Slit3 functions as a tumor suppressor in lung carcinoma.
25051436 Estrogen-dependent expression of SLIT3 may play a key role in regulating nerve-vessel interactions within the complex microenvironment of endometriosis lesions.
24286238 SLIT3 is increased with labour, and both amnion and myometrial studies describe a pro-inflammatory effect of SLIT3 in these tissues.
24158112 High SLIT3 expression is associated with high-grade gliomas.
24090675 SLIT3-ROBO4 activation promotes vascular network formation in human engineered tissue and angiogenesis in vivo.
23720784 results implicate the involvement of miR-218-2 and its host gene SLIT3 in thyroid cancer cell invasion, migration, and proliferation
22614124 Slit3 treatment increased the in vivo homing efficiency of CD34 HSPCs to the BM in NOD/SCID mice, whereas Slit3-exposed HSPC migration in vitro was inhibited. Results support a role for Slit3 in human HSPC migration in vitro and homing in vivo.
21465248 three major members (Slit2/3 and Robo1) of Slit/Robo family are widely expressed in the human normal and malignant ovarian tissues; but Slit/Robo signaling may not play an important role in regulating human ovarian cancer cell proliferation and migration
21152026 SLIT3 duplication on 5q35.1 predisposes to major depressive disorder
More...

AA Sequence

MAPGWAGVGAAVRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDR      1 - 70
NNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDL     71 - 140
SENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTL    141 - 210
RLHSNHLYCDCHLAWLSDWLRQRRTVGQFTLCMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSISC    211 - 280
PSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDA    281 - 350
FQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISK    351 - 420
GLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED    421 - 490
YRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLR    491 - 560
KINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSS    561 - 630
VRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIP    631 - 700
IQDVAIQDFTCDGNEESSCQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRE    701 - 770
LSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPE    771 - 840
GSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPVD    841 - 910
INIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGF    911 - 980
SCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAK    981 - 1050
CIPLDKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPPPMVLLQT   1051 - 1120
SPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDK   1121 - 1190
DNGILLYKGDNDPLALELYQGHVRLVYDSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPK   1191 - 1260
SLGKLQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSP   1261 - 1330
GCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGD   1331 - 1400
LCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKGYASCATA   1401 - 1470
SKVPIMECRGGCGPQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCLACS                    1471 - 1523
//

Text Mined References (42)

PMID Year Title
26542734 2015 Function of Slit/Robo signaling in breast cancer.
26045181 2015 Effects of Slit3 silencing on the invasive ability of lung carcinoma A549 cells.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25051436 2014 Estrogen receptor (ER) agonists differentially regulate neuroangiogenesis in peritoneal endometriosis via the repellent factor SLIT3.
24286238 2014 SLIT3 is increased in supracervical human foetal membranes and in labouring myometrium and regulates pro-inflammatory mediators.
24158112 2013 Experimental validation of 5 in-silico predicted glioma biomarkers.
24090675 2013 SLIT3-ROBO4 activation promotes vascular network formation in human engineered tissue and angiogenesis in vivo.
23720784 2013 Down-regulation of miR-218-2 and its host gene SLIT3 cooperate to promote invasion and progression of thyroid cancer.
22922792 2012 Fragments of SLIT3 inhibit cellular migration.
More...