Property Summary

NCBI Gene PubMed Count 39
PubMed Score 163.81
PubTator Score 31.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -1.300 8.0e-05
Astrocytoma, Pilocytic -1.100 1.6e-07
Atopic dermatitis -1.500 1.7e-04
Breast cancer -1.200 4.6e-02
breast carcinoma -1.800 3.8e-05
colon cancer -1.600 6.2e-05
cutaneous lupus erythematosus -1.100 1.9e-03
ductal carcinoma in situ -1.100 8.2e-04
ependymoma -1.100 6.0e-07
fibroadenoma -1.100 3.5e-02
glioblastoma -1.200 2.7e-09
group 3 medulloblastoma -1.200 6.4e-05
intraductal papillary-mucinous adenoma (... -1.500 6.4e-05
intraductal papillary-mucinous carcinoma... -1.500 1.3e-04
intraductal papillary-mucinous neoplasm ... -1.600 1.1e-03
invasive ductal carcinoma -1.375 1.0e-02
lung adenocarcinoma -1.300 6.0e-10
lung cancer -3.100 6.2e-06
lung carcinoma -1.500 6.2e-10
malignant mesothelioma -4.600 3.4e-09
non-small cell lung cancer -1.415 9.9e-22
ovarian cancer -1.100 5.4e-06
psoriasis 1.200 1.6e-02
subependymal giant cell astrocytoma -1.291 1.6e-02

Protein-protein Interaction (2)

Gene RIF (24)

AA Sequence

MAPGWAGVGAAVRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDR      1 - 70
NNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDL     71 - 140
SENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRALRDLEILTLNNNNISRILVTSFNHMPKIRTL    141 - 210
RLHSNHLYCDCHLAWLSDWLRQRRTVGQFTLCMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSISC    211 - 280
PSPCTCSNNIVDCRGKGLMEIPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDA    281 - 350
FQGLKSLTSLVLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISK    351 - 420
GLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCSGSED    421 - 490
YRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLNDNEVSVLEATGIFKKLPNLR    491 - 560
KINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSS    561 - 630
VRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIP    631 - 700
IQDVAIQDFTCDGNEESSCQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRE    701 - 770
LSALRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPE    771 - 840
GSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPTHRFQCKGPVD    841 - 910
INIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCIQNPCQHGGTCHLSDSHKDGF    911 - 980
SCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVCICPPNYTGELCDEVIDHCVPELNLCQHEAK    981 - 1050
CIPLDKGFSCECVPGYSGKLCETDNDDCVAHKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPPPMVLLQT   1051 - 1120
SPCDQYECQNGAQCIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDK   1121 - 1190
DNGILLYKGDNDPLALELYQGHVRLVYDSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPK   1191 - 1260
SLGKLQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKALPPQSLGVSP   1261 - 1330
GCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHGKCVATGTSYMCKCAEGYGGD   1331 - 1400
LCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKGYASCATA   1401 - 1470
SKVPIMECRGGCGPQCCQPTRSKRRKYVFQCTDGSSFVEEVERHLECGCLACS                    1471 - 1523
//

Text Mined References (42)

PMID Year Title