Property Summary

NCBI Gene PubMed Count 61
PubMed Score 66.43
PubTator Score 36.70

Knowledge Summary

Patent (12,167)

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease -1.087 2.7e-02
active ulcerative colitis -1.853 2.9e-03
acute myeloid leukemia -1.100 2.2e-02
acute quadriplegic myopathy -1.345 2.9e-06
astrocytic glioma 1.100 3.0e-03
atypical teratoid / rhabdoid tumor 2.400 6.8e-06
Breast cancer -2.800 3.0e-12
breast carcinoma -1.500 2.4e-21
chronic kidney disease 1.100 4.5e-02
colon cancer -1.900 4.3e-02
cystic fibrosis -1.791 6.4e-06
ependymoma 1.900 3.2e-02
glioblastoma 1.700 1.7e-02
group 3 medulloblastoma 2.400 2.6e-02
interstitial cystitis -1.200 5.1e-03
intraductal papillary-mucinous adenoma (... -1.900 2.1e-02
lung cancer -2.100 4.5e-03
nasopharyngeal carcinoma 1.100 2.5e-02
non primary Sjogren syndrome sicca 1.100 1.4e-02
oligodendroglioma 1.200 7.2e-05
osteosarcoma 1.425 1.3e-02
ovarian cancer -2.900 3.1e-08
Pick disease 1.400 6.8e-03
pituitary cancer -2.600 6.4e-06
primary pancreatic ductal adenocarcinoma 1.201 8.0e-04
psoriasis -1.600 1.1e-06
subependymal giant cell astrocytoma -3.156 7.6e-03

Gene RIF (40)

AA Sequence

MRDPGAAAPLSSLGLCALVLALLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNL      1 - 70
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGF     71 - 140
QWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSC    141 - 210
PRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMR    211 - 280
RFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMAS    281 - 350
SIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA    351 - 420
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYF    421 - 490
YEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRF    491 - 560
YHRLSHSSKGETAV                                                            561 - 574
//

Text Mined References (63)

PMID Year Title