Property Summary

NCBI Gene PubMed Count 50
Grant Count 25
R01 Count 16
Funding $1,869,890.35
PubMed Score 55.94
PubTator Score 36.70

Knowledge Summary

Patent (12,167)

Expression

  Differential Expression (27)

Disease log2 FC p
astrocytoma 1.900 0.046
ependymoma 2.300 0.026
psoriasis -1.700 0.000
glioblastoma 2.700 0.004
oligodendroglioma 1.200 0.000
osteosarcoma 1.425 0.013
cystic fibrosis -1.945 0.000
atypical teratoid / rhabdoid tumor 2.400 0.000
acute quadriplegic myopathy -1.506 0.000
chronic kidney disease 1.100 0.045
primary pancreatic ductal adenocarcinoma 1.201 0.001
intraductal papillary-mucinous adenoma (... -2.700 0.003
colon cancer -1.900 0.043
lung cancer -2.100 0.005
active Crohn's disease -1.087 0.027
active ulcerative colitis -1.853 0.003
interstitial cystitis -1.200 0.005
group 3 medulloblastoma 2.400 0.026
non primary Sjogren syndrome sicca 1.100 0.014
subependymal giant cell astrocytoma -3.635 0.012
nasopharyngeal carcinoma 1.600 0.005
Breast cancer -2.800 0.000
breast carcinoma -1.500 0.000
Pick disease 1.400 0.007
acute myeloid leukemia -1.100 0.022
ovarian cancer -3.900 0.000
pituitary cancer -2.900 0.000

Gene RIF (32)

PMID Text
26808375 FZD7 activated JNK in melanoma cell lines in vitro and the expression of a dominant negative JNK suppressed metastasis formation in vivo, suggesting that FZD7 may promote metastatic growth of melanoma cells via activation of JNK
26744382 SNX27 inhibits the Wnt regulated transcription activity of TCF/LEF. Our results suggested that SNX27 interacts with Frizzled receptors to regulate the endocytosis and stability of Fzds
26703210 conclusion, our study suggests that miR-613 functions as a tumor suppressor, partially through targeting Fzd7, and is a potential therapeutic target for prostate cancer.
26498690 Data show that cell proliferation and tumor growth decreased significantly after transfection with the plasmid frizzled 7 protein (FZD7)-Shiga-like toxin I (Stx1).
25976503 High expression of FZD7 is associated with cervical cancer.
25740178 High FZD7 expression is associated with cell migration, invasion, and epithelial-mesenchymal transition of cervical cancer.
25313882 Expression of FZD7 was inversely correlated with miR-199a in both hepatocellular carcinoma tissues and cells and over-expression of miR-199a significantly down-regulates the expression of genes downstream of FZD7.
25241036 Data indicate that Wnt receptor Fzd7-dependent enhancement of Wnt signalling by DeltaNp63 governs tumour-initiating activity of the basal subtype of breast cancer.
25032869 Knockdown of FZD7 in Stem-A subtype of ovarian cancer cells showed reduced cell proliferation with an increase in the G0/G1 sub-population.
24897117 Frizzled 7 expression is positively regulated by SIRT1 and beta-catenin in breast cancer cells.
More...

AA Sequence

MRDPGAAAPLSSLGLCALVLALLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNL      1 - 70
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGF     71 - 140
QWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSC    141 - 210
PRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMR    211 - 280
RFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMAS    281 - 350
SIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA    351 - 420
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYF    421 - 490
YEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRF    491 - 560
YHRLSHSSKGETAV                                                            561 - 574
//

Text Mined References (52)

PMID Year Title
27386966 2016 Frizzled 7 and PIP2 binding by syntenin PDZ2 domain supports Frizzled 7 trafficking and signalling.
26808375 2016 FRIZZLED7 Is Required for Tumor Inititation and Metastatic Growth of Melanoma Cells.
26744382 2016 Sorting nexin 27 interacts with Fzd7 and mediates Wnt signalling.
26703210 2016 MicroRNA-613 represses prostate cancer cell proliferation and invasion through targeting Frizzled7.
26498690 2015 Frizzled-7 promoter is highly active in tumors and promoter-driven Shiga-like toxin I inhibits hepatocellular carcinoma growth.
25976503 2015 MicroRNA-142-3p inhibits cell proliferation and invasion of cervical cancer cells by targeting FZD7.
25740178 2015 Down-regulation of Frizzled-7 expression inhibits migration, invasion, and epithelial-mesenchymal transition of cervical cancer cell lines.
25313882 2014 MiR-199a regulates cell proliferation and survival by targeting FZD7.
25241036 2014 ?Np63 promotes stem cell activity in mammary gland development and basal-like breast cancer by enhancing Fzd7 expression and Wnt signalling.
25032869 2014 FZD7 drives in vitro aggressiveness in Stem-A subtype of ovarian cancer via regulation of non-canonical Wnt/PCP pathway.
More...