Property Summary

NCBI Gene PubMed Count 26
Grant Count 23
R01 Count 17
Funding $2,599,722.9
PubMed Score 43.30
PubTator Score 22.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
pancreatic cancer -1.500 0.030
malignant mesothelioma -3.000 0.000
ependymoma 1.600 0.000
oligodendroglioma 1.200 0.007
esophageal adenocarcinoma -1.200 0.024
psoriasis 2.000 0.000
osteosarcoma 1.959 0.002
glioblastoma 2.000 0.007
astrocytoma 1.500 0.005
atypical teratoid / rhabdoid tumor 2.100 0.001
medulloblastoma 1.200 0.014
medulloblastoma, large-cell 1.300 0.002
primary pancreatic ductal adenocarcinoma 1.610 0.000
breast carcinoma 1.900 0.003
diabetes mellitus -1.100 0.002
pediatric high grade glioma 1.500 0.011
pancreatic carcinoma -1.500 0.030
Polycystic Ovary Syndrome -1.417 0.005
ovarian cancer 2.000 0.000

 GO Function (1)

Gene RIF (10)

PMID Text
25792565 Demonstrate a previously unanticipated role of Aip1 in regulating the structure and remodeling of intestinal epithelial junctions and early steps of epithelial morphogenesis.
24516586 When maternal environmental tobacco smoke was considered, fifteen of 135 single nucleotide polymorphism (SNPs) mapping to SLC2A9 and 9 of 59 SNPs in WDR1 gave P values approaching genome-wide significance.
23707566 WD repeat-containing protein 1 was confirmed as being significantly overexpressed in interstitial fluid from ovarian carcinomas compared to healthy ovarian tissue.
23293323 Studies suggest that vascular endothelial growth factor may be responsible for upregulated P-glycoprotein expression.
23215816 Data suggest that anti-WD repeat domain 1 (WDR1) antibody could be applied for serological screening of papillary thyroid carcinoma (PTC) and undifferentiated thyroid carcinoma (UTC), and could be an efficient and inexpensive biomarker.
20631256 The QKI RNA-binding proteins regulate oligodendrocyte differentiation by modulating the expression of AIP-1.
19818632 Studies indicate that CUL4 uses a large beta-propeller protein, DDB1, as a linker to interact with a subset of WD40 proteins.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18494608 Data indicates that Aip1 plays an important role in directional cell migration by restricting the stimulus-induced membrane protrusion to one direction via promoting cofilin activity.
15629458 AIP1/WDR1 could abort the severing/disassembly activity somewhat still carried out due to phosphorylated ADF/cofilin

AA Sequence

MPYEIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDNPALADIYTEHAHQVVVAKYAPSG      1 - 70
FYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVG     71 - 140
EITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASAD    141 - 210
GQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLD    211 - 280
QQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWD    281 - 350
SETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGY    351 - 420
AVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKG    421 - 490
PVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVWT    491 - 560
LSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTITY                            561 - 606
//

Text Mined References (35)

PMID Year Title
25792565 2015 Actin-interacting protein 1 controls assembly and permeability of intestinal epithelial apical junctions.
24516586 2014 Evidence of gene-environment interaction for two genes on chromosome 4 and environmental tobacco smoke in controlling the risk of nonsyndromic cleft palate.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23707566 2013 Increased WD-repeat containing protein 1 in interstitial fluid from ovarian carcinomas shown by comparative proteomic analysis of malignant and healthy gynecological tissue.
23293323 2013 Tumour endothelial cells acquire drug resistance in a tumour microenvironment.
23215816 2013 Autoantibody against WD repeat domain 1 is a novel serological biomarker for screening of thyroid neoplasia.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22721921 Proteomic analysis of podosome fractions from macrophages reveals similarities to spreading initiation centres.
22229870 2012 Genome-wide association of serum uric acid concentration: replication of sequence variants in an island population of the Adriatic coast of Croatia.
21943158 2011 Genetic variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits.
More...