Property Summary

NCBI Gene PubMed Count 33
PubMed Score 45.29
PubTator Score 22.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytoma 1.500 4.8e-03
atypical teratoid / rhabdoid tumor 1.500 8.6e-06
breast carcinoma 1.900 3.5e-03
diabetes mellitus -1.100 1.8e-03
ependymoma 1.100 8.5e-03
esophageal adenocarcinoma -1.200 2.4e-02
glioblastoma 1.300 1.2e-07
malignant mesothelioma -1.600 7.1e-06
medulloblastoma 1.200 1.4e-02
medulloblastoma, large-cell 1.300 1.6e-03
oligodendroglioma 1.200 7.5e-03
osteosarcoma 1.959 1.6e-03
ovarian cancer -1.600 3.9e-05
pancreatic cancer -1.500 3.0e-02
pancreatic carcinoma -1.500 3.0e-02
pediatric high grade glioma 1.300 5.7e-05
Polycystic ovary syndrome -1.417 4.6e-03
primary pancreatic ductal adenocarcinoma 1.610 3.5e-04
psoriasis 1.600 1.7e-04

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (17)

AA Sequence

MPYEIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDNPALADIYTEHAHQVVVAKYAPSG      1 - 70
FYIASGDVSGKLRIWDTTQKEHLLKYEYQPFAGKIKDIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVG     71 - 140
EITGHNKVINSVDIKQSRPYRLATGSDDNCAAFFEGPPFKFKFTIGDHSRFVNCVRFSPDGNRFATASAD    141 - 210
GQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLD    211 - 280
QQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWD    281 - 350
SETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGY    351 - 420
AVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKG    421 - 490
PVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVWT    491 - 560
LSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKEWTITY                            561 - 606
//

Text Mined References (42)

PMID Year Title