Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.88
PubTator Score 19.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.300 6.4e-08
astrocytic glioma -1.200 3.1e-03
Astrocytoma, Pilocytic -2.600 1.4e-12
atypical teratoid / rhabdoid tumor -2.300 2.1e-10
ependymoma -1.500 2.0e-03
glioblastoma -2.100 7.8e-12
group 3 medulloblastoma -1.100 5.0e-03
medulloblastoma, large-cell -1.800 2.4e-04
osteosarcoma 1.075 8.9e-04
ovarian cancer -1.100 7.7e-06
primitive neuroectodermal tumor -1.800 1.9e-04

Gene RIF (1)

AA Sequence

MRLLRRWAFAALLLSLLPTPGLGTQGPAGALRWGGLPQLGGPGAPEVTEPSRLVRESSGGEVRKQQLDTR      1 - 70
VRQEPPGGPPVHLAQVSFVIPAFNSNFTLDLELNHHLLSSQYVERHFSREGTTQHSTGAGDHCYYQGKLR     71 - 140
GNPHSFAALSTCQGLHGVFSDGNLTYIVEPQEVAGPWGAPQGPLPHLIYRTPLLPDPLGCREPGCLFAVP    141 - 210
AQSAPPNRPRLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQ    211 - 280
LNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICS    281 - 350
LSHGGGVNEYGNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSRCSID    351 - 420
EYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTLTHDAMCSDGLC    421 - 490
CRRCKYEPRGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHEQGRCYGGRCKTRDRQCQVLWGH    491 - 560
AAADRFCYEKLNVEGTERGSCGRKGSGWVQCSKQDVLCGFLLCVNISGAPRLGDLVGDISSVTFYHQGKE    561 - 630
LDCRGGHVQLADGSDLSYVEDGTACGPNMLCLDHRCLPASAFNFSTCPGSGERRICSHHGVCSNEGKCIC    631 - 700
QPDWTGKDCSIHNPLPTSPPTGETERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFKNIRRGRSGGA     701 - 769
//

Text Mined References (13)

PMID Year Title