Property Summary

NCBI Gene PubMed Count 28
PubMed Score 20.95
PubTator Score 24.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 1.066 3.8e-02
adult high grade glioma -1.500 6.7e-04
Amyotrophic lateral sclerosis 1.437 5.2e-09
astrocytic glioma -1.800 2.2e-02
atypical teratoid / rhabdoid tumor -2.200 3.5e-05
diabetes mellitus -1.300 6.4e-03
ependymoma -2.300 1.6e-02
glioblastoma -1.600 1.0e-04
group 3 medulloblastoma -1.700 1.1e-03
lung carcinoma 1.400 7.7e-10
malignant mesothelioma 1.100 1.0e-04
medulloblastoma, large-cell -1.200 8.8e-03
nasopharyngeal carcinoma 2.600 2.3e-03
non-small cell lung cancer 1.566 1.2e-07
osteosarcoma -2.603 2.1e-03
Pick disease -1.100 1.7e-04
pituitary cancer 1.100 4.4e-03
primitive neuroectodermal tumor -1.200 2.6e-03
psoriasis 1.900 1.0e-105

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (16)

AA Sequence

MKPPGSSSRQPPLAGCSLAGASCGPQRGPAGSVPASAPARTPPCRLLLVLLLLPPLAASSRPRAWGAAAP      1 - 70
SAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQ     71 - 140
KHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEIHYENGKPQYSKGGEHCYYHGSIRGVKDSKV    141 - 210
ALSTCNGLHGMFEDDTFVYMIEPLELVHDEKSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQW    211 - 280
LKRRKRAVNPSRGIFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAV    281 - 350
ETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYG    351 - 420
LPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGA    421 - 490
CLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYEC    491 - 560
RDAVNECDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCYNGECKTRDNQCQYIWGTKAAGSDKFCYEKL    561 - 630
NTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLD    631 - 700
DDTDVGYVEDGTPCGPSMMCLDRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSI    701 - 770
RDPVRNLHPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI            771 - 832
//

Text Mined References (29)

PMID Year Title