Property Summary

NCBI Gene PubMed Count 26
PubMed Score 17.85
PubTator Score 24.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 1.01983465184039E-105
posterior fossa group A ependymoma 1511 1.83606308487547E-14
lung carcinoma 2844 7.71897649078468E-10
Amyotrophic Lateral Sclerosis 432 5.21669420568648E-9
non-small cell lung cancer 2798 1.19587839609535E-7
medulloblastoma, large-cell 6234 2.26565678773703E-5
atypical teratoid / rhabdoid tumor 4369 3.49823370157241E-5
group 4 medulloblastoma 1875 3.71269613191651E-5
pediatric high grade glioma 2712 3.92691837033707E-5
pituitary cancer 1972 4.58345585629947E-5
malignant mesothelioma 3163 1.00876277396885E-4
glioblastoma 5572 1.67529899820944E-4
osteosarcoma 7933 0.00211951310397485
nasopharyngeal carcinoma 1056 0.00231087119335288
primitive neuroectodermal tumor 3031 0.00257322490486165
Pick disease 1893 0.00300221916247982
diabetes mellitus 1663 0.00637791581604965
astrocytic glioma 2241 0.0217538154073948
adrenocortical carcinoma 1427 0.0382891121985158
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Bruxism 19 3.76 1.9
Epilepsy 346 3.245 1.6

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
astrocytic glioma -1.800 0.022
posterior fossa group A ependymoma -2.900 0.000
osteosarcoma -2.603 0.002
glioblastoma -2.700 0.000
group 4 medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -2.900 0.000
primitive neuroectodermal tumor -1.200 0.003
Amyotrophic Lateral Sclerosis 1.437 0.000
adrenocortical carcinoma 1.066 0.038
non-small cell lung cancer 1.566 0.000
diabetes mellitus -1.300 0.006
pediatric high grade glioma -2.200 0.000
nasopharyngeal carcinoma 2.600 0.002
lung carcinoma 1.400 0.000
Pick disease -2.200 0.003
pituitary cancer 2.200 0.000
psoriasis 1.900 0.000

Synonym

Accession O75077 A2RU59 ADAM 23
Symbols MDC3
MDC-3

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

Gene RIF (14)

PMID Text
26800504 Our data provide evidence that ADAM23 plays a role in suppression of cancer cell progression through interaction with aVb3 integrin, and suggest that downregulation of ADAM23 in SP cells may contribute toward providing a cancer stem cell phenotype
25740824 High ADAM23 gene methylation is associated with gastric tumor aggressiveness.
25620615 quantification of CXCL12 and ADAM23 methylation could be useful for the prediction of advanced stage of BC
24662834 Intratumoral heterogeneity of ADAM23 promotes tumor growth and metastasis through LGI4 and nitric oxide signals.
23898208 HIV-1 Tat downregulates the expression of ADAM metallopeptidase domain 23 (ADAM23) in human primary T cells
21429053 The expression level of ADAM23 is likely to be involved in the progression of non-small-cell lung carcinoma, and its downregulation is probably correlated with promoter methylation.
20851106 a SP1 binding site (-202/-190) that binds SP1 at the proximal promoter of human ADAM23 gene was indentified.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19824886 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19549921 Functional role of ADAM23 during lung caner metastatic progression by negatively modulating alpha(v)beta(3) integrin activation.
More...

AA Sequence

MKPPGSSSRQPPLAGCSLAGASCGPQRGPAGSVPASAPARTPPCRLLLVLLLLPPLAASSRPRAWGAAAP      1 - 70
SAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQ     71 - 140
KHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEIHYENGKPQYSKGGEHCYYHGSIRGVKDSKV    141 - 210
ALSTCNGLHGMFEDDTFVYMIEPLELVHDEKSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQW    211 - 280
LKRRKRAVNPSRGIFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAV    281 - 350
ETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYG    351 - 420
LPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGA    421 - 490
CLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYEC    491 - 560
RDAVNECDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCYNGECKTRDNQCQYIWGTKAAGSDKFCYEKL    561 - 630
NTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLD    631 - 700
DDTDVGYVEDGTPCGPSMMCLDRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSI    701 - 770
RDPVRNLHPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI            771 - 832
//

Text Mined References (27)

PMID Year Title
26800504 2016 ADAM23 is downregulated in side population and suppresses lung metastasis of lung carcinoma cells.
25740824 2015 Epigenetic clustering of gastric carcinomas based on DNA methylation profiles at the precancerous stage: its correlation with tumor aggressiveness and patient outcome.
25620615 2015 CXCL12 and ADAM23 hypermethylation are associated with advanced breast cancers.
24662834 2015 Intratumoral heterogeneity of ADAM23 promotes tumor growth and metastasis through LGI4 and nitric oxide signals.
22937229 2011 ADAM23, a Gene Related to LGI1, Is Not Linked to Autosomal Dominant Lateral Temporal Epilepsy.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
21429053 2011 The expression of ADAM23 and its correlation with promoter methylation in non-small-cell lung carcinoma.
20851106 2010 SP1 acts as a key factor, contributes to upregulation of ADAM23 expression under serum deprivation.
20463223 2010 LGI1 is a Nogo receptor 1 ligand that antagonizes myelin-based growth inhibition.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...