Property Summary

NCBI Gene PubMed Count 26
PubMed Score 17.85
PubTator Score 24.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
astrocytic glioma -1.800 0.022
posterior fossa group A ependymoma -2.900 0.000
osteosarcoma -2.603 0.002
glioblastoma -2.700 0.000
group 4 medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -2.900 0.000
primitive neuroectodermal tumor -1.200 0.003
Amyotrophic Lateral Sclerosis 1.437 0.000
adrenocortical carcinoma 1.066 0.038
non-small cell lung cancer 1.566 0.000
diabetes mellitus -1.300 0.006
pediatric high grade glioma -2.200 0.000
nasopharyngeal carcinoma 2.600 0.002
lung carcinoma 1.400 0.000
Pick disease -2.200 0.003
pituitary cancer 2.200 0.000
psoriasis 1.900 0.000

Synonym

Accession O75077 A2RU59 ADAM 23
Symbols MDC3
MDC-3

Gene

Gene RIF (14)

PMID Text
26800504 Our data provide evidence that ADAM23 plays a role in suppression of cancer cell progression through interaction with aVb3 integrin, and suggest that downregulation of ADAM23 in SP cells may contribute toward providing a cancer stem cell phenotype
25740824 High ADAM23 gene methylation is associated with gastric tumor aggressiveness.
25620615 quantification of CXCL12 and ADAM23 methylation could be useful for the prediction of advanced stage of BC
24662834 Intratumoral heterogeneity of ADAM23 promotes tumor growth and metastasis through LGI4 and nitric oxide signals.
23898208 HIV-1 Tat downregulates the expression of ADAM metallopeptidase domain 23 (ADAM23) in human primary T cells
21429053 The expression level of ADAM23 is likely to be involved in the progression of non-small-cell lung carcinoma, and its downregulation is probably correlated with promoter methylation.
20851106 a SP1 binding site (-202/-190) that binds SP1 at the proximal promoter of human ADAM23 gene was indentified.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19824886 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19549921 Functional role of ADAM23 during lung caner metastatic progression by negatively modulating alpha(v)beta(3) integrin activation.
More...

AA Sequence

MKPPGSSSRQPPLAGCSLAGASCGPQRGPAGSVPASAPARTPPCRLLLVLLLLPPLAASSRPRAWGAAAP      1 - 70
SAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQ     71 - 140
KHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEIHYENGKPQYSKGGEHCYYHGSIRGVKDSKV    141 - 210
ALSTCNGLHGMFEDDTFVYMIEPLELVHDEKSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQW    211 - 280
LKRRKRAVNPSRGIFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAV    281 - 350
ETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYG    351 - 420
LPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGA    421 - 490
CLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYEC    491 - 560
RDAVNECDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCYNGECKTRDNQCQYIWGTKAAGSDKFCYEKL    561 - 630
NTEGTEKGNCGKDGDRWIQCSKHDVFCGFLLCTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLD    631 - 700
DDTDVGYVEDGTPCGPSMMCLDRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSI    701 - 770
RDPVRNLHPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI            771 - 832
//

Text Mined References (27)

PMID Year Title
26800504 2016 ADAM23 is downregulated in side population and suppresses lung metastasis of lung carcinoma cells.
25740824 2015 Epigenetic clustering of gastric carcinomas based on DNA methylation profiles at the precancerous stage: its correlation with tumor aggressiveness and patient outcome.
25620615 2015 CXCL12 and ADAM23 hypermethylation are associated with advanced breast cancers.
24662834 2015 Intratumoral heterogeneity of ADAM23 promotes tumor growth and metastasis through LGI4 and nitric oxide signals.
22937229 2011 ADAM23, a Gene Related to LGI1, Is Not Linked to Autosomal Dominant Lateral Temporal Epilepsy.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
21429053 2011 The expression of ADAM23 and its correlation with promoter methylation in non-small-cell lung carcinoma.
20851106 2010 SP1 acts as a key factor, contributes to upregulation of ADAM23 expression under serum deprivation.
20463223 2010 LGI1 is a Nogo receptor 1 ligand that antagonizes myelin-based growth inhibition.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...