Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.10
PubTator Score 1.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.200 1.7e-03
Astrocytoma, Pilocytic -1.100 2.7e-05
atypical teratoid/rhabdoid tumor -1.300 2.9e-07
ependymoma -1.200 1.9e-02
glioblastoma -1.100 9.9e-06
osteosarcoma -3.714 1.5e-07
subependymal giant cell astrocytoma -1.748 1.2e-02

Protein-protein Interaction (10)

AA Sequence

MKRCRSDELQQQQGEEDGAGLEDAASHLPGADLRPGETTGANSAGGPTSDAGAAAAPNPGPRSKPPDLKK      1 - 70
IQQLSEGSMFGHGLKHLFHSRRRSREREHQTSQDSQQHQQQQGMSDHDSPDEKERSPEMHRVSYAMSLHD     71 - 140
LPARPTAFNRVLQQIRSRPSIKRGASLHSSSGGGSSGSSSRRTKSSSLEPQRGSPHLLRKAPQDSSLAAI    141 - 210
LHQHQCRPRSSSTTDTALLLADGSNVYLLAEEAEGIGDKVDKGDLVALSLPAGHGDTDGPISLDVPDGAP    211 - 280
DPQRTKAAIDHLHQKILKITEQIKIEQEARDDNVAEYLKLANNADKQQVSRIKQVFEKKNQKSAQTIAQL    281 - 350
HKKLEHYRRRLKEIEQNGPSRQPKDVLRDMQQGLKDVGANVRAGISGFGGGVVEGVKGSLSGLSQATHTA    351 - 420
VVSKPREFASLIRNKFGSADNIAHLKDPLEDGPPEEAARALSGSATLVSSPKYGSDDECSSASASSAGAG    421 - 490
SNSGAGPGGALGSPKSNALYGAPGNLDALLEELREIKEGQSHLEDSMEDLKTQLQRDYTYMTQCLQEERY    491 - 560
RYERLEEQLNDLTELHQNEMTNLKQELASMEEKVAYQSYERARDIQEAVESCLTRVTKLELQQQQQQVVQ    561 - 630
LEGVENANARALLGKFINVILALMAVLLVFVSTIANFITPLMKTRLRITSTTLLVLVLFLLWKHWDSLTY    631 - 700
LLEHVLLPS                                                                 701 - 709
//

Text Mined References (18)

PMID Year Title