Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.10
PubTator Score 1.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Platelet mean volume finding 31
Disease Target Count P-value
ependymoma 2514 5.08648473312437E-19
osteosarcoma 7933 1.5378659124415E-7
atypical teratoid/rhabdoid tumor 1095 2.91375761924203E-7
glioblastoma 5572 9.9150217287727E-6
pilocytic astrocytoma 3086 2.29733926275965E-5
adult high grade glioma 2148 0.00173187530888445
subependymal giant cell astrocytoma 2287 0.0118103060347686
Disease Target Count Z-score Confidence
Hemolytic anemia 70 0.0 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma -1.800 0.000
osteosarcoma -3.714 0.000
glioblastoma -1.100 0.000
adult high grade glioma -1.200 0.002
atypical teratoid/rhabdoid tumor -1.300 0.000
pilocytic astrocytoma -1.100 0.000
subependymal giant cell astrocytoma -1.748 0.012

Synonym

Accession O75069 A2RRH3 B7Z1P7 Q6ZN09
Symbols HUCEP11

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA EggNOG

AA Sequence

MKRCRSDELQQQQGEEDGAGLEDAASHLPGADLRPGETTGANSAGGPTSDAGAAAAPNPGPRSKPPDLKK      1 - 70
IQQLSEGSMFGHGLKHLFHSRRRSREREHQTSQDSQQHQQQQGMSDHDSPDEKERSPEMHRVSYAMSLHD     71 - 140
LPARPTAFNRVLQQIRSRPSIKRGASLHSSSGGGSSGSSSRRTKSSSLEPQRGSPHLLRKAPQDSSLAAI    141 - 210
LHQHQCRPRSSSTTDTALLLADGSNVYLLAEEAEGIGDKVDKGDLVALSLPAGHGDTDGPISLDVPDGAP    211 - 280
DPQRTKAAIDHLHQKILKITEQIKIEQEARDDNVAEYLKLANNADKQQVSRIKQVFEKKNQKSAQTIAQL    281 - 350
HKKLEHYRRRLKEIEQNGPSRQPKDVLRDMQQGLKDVGANVRAGISGFGGGVVEGVKGSLSGLSQATHTA    351 - 420
VVSKPREFASLIRNKFGSADNIAHLKDPLEDGPPEEAARALSGSATLVSSPKYGSDDECSSASASSAGAG    421 - 490
SNSGAGPGGALGSPKSNALYGAPGNLDALLEELREIKEGQSHLEDSMEDLKTQLQRDYTYMTQCLQEERY    491 - 560
RYERLEEQLNDLTELHQNEMTNLKQELASMEEKVAYQSYERARDIQEAVESCLTRVTKLELQQQQQQVVQ    561 - 630
LEGVENANARALLGKFINVILALMAVLLVFVSTIANFITPLMKTRLRITSTTLLVLVLFLLWKHWDSLTY    631 - 700
LLEHVLLPS                                                                 701 - 709
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21593558 2011 The impact of a novel apolipoprotein E and amyloid-? protein precursor-interacting protein on the production of amyloid-?.
19820697 2009 A genome-wide meta-analysis identifies 22 loci associated with eight hematological parameters in the HaemGen consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
More...