Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.46
PubTator Score 2.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.400 4.6e-05
aldosterone-producing adenoma -1.020 3.2e-02
astrocytic glioma -1.200 1.4e-02
atypical teratoid / rhabdoid tumor -1.400 1.0e-05
glioblastoma -1.400 1.1e-05
intraductal papillary-mucinous adenoma (... 1.100 5.1e-03
lung cancer 1.100 1.1e-02
non primary Sjogren syndrome sicca 1.100 3.2e-02
osteosarcoma 1.749 1.1e-04
ovarian cancer -1.100 7.5e-06
psoriasis -1.700 2.8e-05

Gene RIF (1)

AA Sequence

MKLKQRVVLLAILLVIFIFTKVFLIDNLDTSAANREDQRAFHRMMTGLRVELAPKLDHTLQSPWEIAAQW      1 - 70
VVPREVYPEETPELGAVMHAMATKKIIKADVGYKGTQLKALLILEGGQKVVFKPKRYSRDHVVEGEPYAG     71 - 140
YDRHNAEVAAFHLDRILGFHRAPLVVGRFVNLRTEIKPVATEQLLSTFLTVGNNTCFYGKCYYCRETEPA    141 - 210
CADGDIMEGSVTLWLPDVWPLQKHRHPWGRTYREGKLARWEYDESYCDAVKKTSPYDSGPRLLDIIDTAV    211 - 280
FDYLIGNADRHHYESFQDDEGASMLILLDNAKSFGNPSLDERSILAPLYQCCIIRVSTWNRLNYLKNGVL    281 - 350
KSALKSAMAHDPISPVLSDPHLDAVDQRLLSVLATVKQCTDQFGMDTVLVEDRMPLSHL               351 - 409
//

Text Mined References (17)

PMID Year Title