Tdark | Glycosaminoglycan xylosylkinase |
Responsible for the 2-O-phosphorylation of xylose in the glycosaminoglycan-protein linkage region of proteoglycans thereby regulating the amount of mature GAG chains. Sulfated glycosaminoglycans (GAGs), including heparan sulfate and chondroitin sulfate, are synthesized on the so-called common GAG-protein linkage region (GlcUAbeta1-3Galbeta1-3Galbeta1-4Xylbeta1-O-Ser) of core proteins, which is formed by the stepwise addition of monosaccharide residues by the respective specific glycosyltransferases. Xylose 2-O-phosphorylation may influence the catalytic activity of B3GAT3 (GlcAT-I) which completes the precursor tetrasaccharide of GAG-protein linkage regions on which the repeating disaccharide region is synthesized.
Comments
Disease | Target Count | P-value |
---|---|---|
ovarian cancer | 8492 | 7.45021821422172E-6 |
atypical teratoid / rhabdoid tumor | 4369 | 1.04227432993669E-5 |
glioblastoma | 5572 | 1.07993721164483E-5 |
psoriasis | 6685 | 2.80675121901971E-5 |
adult high grade glioma | 2148 | 4.57038731081526E-5 |
osteosarcoma | 7933 | 1.14510646335001E-4 |
intraductal papillary-mucinous adenoma (IPMA) | 2956 | 0.00509531928641746 |
lung cancer | 4473 | 0.0105534855936776 |
astrocytic glioma | 2241 | 0.0136688546229316 |
aldosterone-producing adenoma | 664 | 0.0315971154661732 |
non primary Sjogren syndrome sicca | 840 | 0.0323818770885069 |
Disease | log2 FC | p |
---|---|---|
astrocytic glioma | -1.200 | 0.014 |
psoriasis | -1.700 | 0.000 |
osteosarcoma | 1.749 | 0.000 |
atypical teratoid / rhabdoid tumor | -1.400 | 0.000 |
glioblastoma | -1.400 | 0.000 |
intraductal papillary-mucinous adenoma (... | 1.100 | 0.005 |
lung cancer | 1.100 | 0.011 |
adult high grade glioma | -1.400 | 0.000 |
non primary Sjogren syndrome sicca | 1.100 | 0.032 |
aldosterone-producing adenoma | -1.020 | 0.032 |
ovarian cancer | -1.100 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
Fruitfly | OMA Inparanoid |
MKLKQRVVLLAILLVIFIFTKVFLIDNLDTSAANREDQRAFHRMMTGLRVELAPKLDHTLQSPWEIAAQW 1 - 70 VVPREVYPEETPELGAVMHAMATKKIIKADVGYKGTQLKALLILEGGQKVVFKPKRYSRDHVVEGEPYAG 71 - 140 YDRHNAEVAAFHLDRILGFHRAPLVVGRFVNLRTEIKPVATEQLLSTFLTVGNNTCFYGKCYYCRETEPA 141 - 210 CADGDIMEGSVTLWLPDVWPLQKHRHPWGRTYREGKLARWEYDESYCDAVKKTSPYDSGPRLLDIIDTAV 211 - 280 FDYLIGNADRHHYESFQDDEGASMLILLDNAKSFGNPSLDERSILAPLYQCCIIRVSTWNRLNYLKNGVL 281 - 350 KSALKSAMAHDPISPVLSDPHLDAVDQRLLSVLATVKQCTDQFGMDTVLVEDRMPLSHL 351 - 409 //
PMID | Year | Title |
---|---|---|
24425863 | 2014 | Identification of phosphatase that dephosphorylates xylose in the glycosaminoglycan-protein linkage region of proteoglycans. |
24270810 | 2013 | High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy. |
20237496 | 2010 | New genetic associations detected in a host response study to hepatitis B vaccine. |
19473117 | 2009 | FAM20B is a kinase that phosphorylates xylose in the glycosaminoglycan-protein linkage region. |
18400750 | 2008 | 2-o-phosphorylation of xylose and 6-o-sulfation of galactose in the protein linkage region of glycosaminoglycans influence the glucuronyltransferase-I activity involved in the linkage region synthesis. |
16710414 | 2006 | The DNA sequence and biological annotation of human chromosome 1. |
16428749 | 2006 | Correlation of molecular characteristics, isotype, and in vitro functional activity of human antipneumococcal monoclonal antibodies. |
15676076 | 2005 | FAM20: an evolutionarily conserved family of secreted proteins expressed in hematopoietic cells. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. |
More... |