Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
R01 Count 2
Funding $279,000
PubMed Score 6.46
PubTator Score 2.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.200 0.014
psoriasis -1.700 0.000
osteosarcoma 1.749 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.400 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.005
lung cancer 1.100 0.011
adult high grade glioma -1.400 0.000
non primary Sjogren syndrome sicca 1.100 0.032
aldosterone-producing adenoma -1.020 0.032
ovarian cancer -1.100 0.000

Synonym

Accession O75063 Q5W0C3 Q5W0C4
Symbols gxk1

Gene

 Grant Application (2)

Gene RIF (1)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKLKQRVVLLAILLVIFIFTKVFLIDNLDTSAANREDQRAFHRMMTGLRVELAPKLDHTLQSPWEIAAQW      1 - 70
VVPREVYPEETPELGAVMHAMATKKIIKADVGYKGTQLKALLILEGGQKVVFKPKRYSRDHVVEGEPYAG     71 - 140
YDRHNAEVAAFHLDRILGFHRAPLVVGRFVNLRTEIKPVATEQLLSTFLTVGNNTCFYGKCYYCRETEPA    141 - 210
CADGDIMEGSVTLWLPDVWPLQKHRHPWGRTYREGKLARWEYDESYCDAVKKTSPYDSGPRLLDIIDTAV    211 - 280
FDYLIGNADRHHYESFQDDEGASMLILLDNAKSFGNPSLDERSILAPLYQCCIIRVSTWNRLNYLKNGVL    281 - 350
KSALKSAMAHDPISPVLSDPHLDAVDQRLLSVLATVKQCTDQFGMDTVLVEDRMPLSHL               351 - 409
//

Text Mined References (15)

PMID Year Title
24425863 2014 Identification of phosphatase that dephosphorylates xylose in the glycosaminoglycan-protein linkage region of proteoglycans.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19473117 2009 FAM20B is a kinase that phosphorylates xylose in the glycosaminoglycan-protein linkage region.
18400750 2008 2-o-phosphorylation of xylose and 6-o-sulfation of galactose in the protein linkage region of glycosaminoglycans influence the glucuronyltransferase-I activity involved in the linkage region synthesis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16428749 2006 Correlation of molecular characteristics, isotype, and in vitro functional activity of human antipneumococcal monoclonal antibodies.
15676076 2005 FAM20: an evolutionarily conserved family of secreted proteins expressed in hematopoietic cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...